Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20580-AT1G76300
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Small nuclear ribonucleoprotein family protein
Function (paralog2):snRNP core protein SMD3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.0749251241261
Log2 mRNA fold difference:-0.97980013451526
Log2 TE fold difference:-0.09652430023791
Sequences
Protein sequence

MSRSLGIPVKLLHEASGHIVTVELKSGELYRGSMIECEDNWNCQLEDITYTAKDGKVSQL
EHVFIRGSKVRFMVIPDILKHAPMFKRLDARIKGKSSSLGVGRGRGAMRGKPAAGPGRGT
GGRGAVPPVRR

MSRSLGIPVKLLHESSGHIVSVEMKSGELYRGSMIECEDNWNCQLENITYTAKDGKVSQL
EHVFIRGSLVRFLVIPDMLKNAPMFKDVRGKGKSASLGVGRGRGAAMRAKGTGRGTGGGR
GAVPPVRR

Other information
Ka divergence:0.347191KaKs divergence:0.663648
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):396Length 2 (bp):387Length divergence:-0.011
MFE 1 (kcal):-126.2MFE 2 (kcal):-118MFE divergence-0.034