Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20590-AT1G20610
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cyclin family protein
Function (paralog2):Cyclin B2;3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.59533335445526
Log2 mRNA fold difference:1.5832740796784
Log2 TE fold difference:-0.96498775207428
Sequences
Protein sequence

MSFLAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRREVLDMEKLMA
NTLQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYEMLEYLPSKLAASAIY
TAQCTLKGFEEWSKTCEFHTGYNEEQLLACARKMVAFHHKAGTGKLTGSTTHLSSFMLQE
VNQLGFCFKGGKNYNKNLI

MVRSDENSLGLIGSMSLQGGGVVGKIKTTATTGPTRRALSTINKNITEAPSYPYAVNKRS
VSERDGICNKPPVHRPVTRKFAAQLADHKPHIRDEETKKPDSVSSEEPETIIIDVDESDK
EGGDSNEPMFVQHTEAMLEEIEQMEKEIEMEDADKEEEPVIDIDACDKNNPLAAVEYIHD
MHTFYKNFEKLSCVPPNYMDNQQDLNERMRGILIDWLIEVHYKFELMEETLYLTINVIDR
FLAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRREVLDMEKLMANT
LQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYEMLEYLPSKLAASAIYTA
QCTLKGFEEWSKTCEFHTGYNEKQLLACARKMVAFHHKAGTGKLTGVHRKYNTSKFCHAA
RTEPAGFLI

Other information
Ka divergence:-0.918352KaKs divergence:0.930275
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):600Length 2 (bp):1290Length divergence:0.365
MFE 1 (kcal):-160.6MFE 2 (kcal):-351.6MFE divergence0.373