Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20590-AT1G76310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cyclin family protein
Function (paralog2):CYCLIN B2;4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3628456056394
Log2 mRNA fold difference:2.7505822455873
Log2 TE fold difference:-1.4089101229687
Sequences
Protein sequence

MSFLAVHQIVRKKLQLVGVTALLLACKYEEVSVPVVDDLILISDKAYSRREVLDMEKLMA
NTLQFNFSLPTPYVFMKRFLKAAQSDKKLEILSFFMIELCLVEYEMLEYLPSKLAASAIY
TAQCTLKGFEEWSKTCEFHTGYNEEQLLACARKMVAFHHKAGTGKLTGSTTHLSSFMLQE
VNQLGFCFKGGKNYNKNLI

MGGSDENRHGVIGPMNRQQGGLRGGKVIPTNGQTRRALSNINKNIIGAPVYPCAVKRPFT
EKNGICNKKIPPVPVHRPVTRKFAAQLAENNLQIHKEETKKPDLISNEALDRIITDVEEG
DFNEPMFVQHTEAMLEEIDKMEGIEMQDSNDIDAEVEESVMDIDSCDKNNPLSVVEYIND
IYCFYKKNECRSCVPPNYMENQHDINERMRGILFDWLIEVHYKFELMEETLYLTINLIDR
FLAVHQHIARKKLQLVGVTAMLLACKYEEVSVPVVDDLILISDKAYTRTEILDMEKLMAN
TLQFNFCLPTPYVFMRRFLKAAQSDKKLELLSFFMIELCLVEYEMLQYTPSQLAASAIYT
AQSTLKGYEDWSKTSEFHSGYTEEALLECSRKMVGLHHKAGTGKLTGVHRKYNTSKFGYA
ARIEPAGFLLL

www.000webhost.com

Other information
Ka divergence:-0.418263KaKs divergence:-0.150706
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):600Length 2 (bp):1296Length divergence:0.367
MFE 1 (kcal):-160.6MFE 2 (kcal):-365.22MFE divergence0.389