Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20640-AT1G76350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant regulator RWP-RK family protein
Function (paralog2):Plant regulator RWP-RK family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.31999390922684
Log2 mRNA fold difference:-0.62847666751713
Log2 TE fold difference:1.0351974320691
Sequences
Protein sequence

MEDSFLQSENVVMDADFMDGLLLDGCWLETTDGSEFLNIAPSTSSVSPFDPTSFMWSPTQ
DTSALCTSGVVSQMYGQDCVERSSLDEFQWNKRWWIGPGGGGSSVTERLVQAVEHIKDYT
TARGSLIQLWVPVNRGGKRVLTTKEQPFSHDPLCQRLANYREISVNYHFSAEQDDSKALA
GLPGRVFLGKLPEWTPDVRFFKSEEYPRVHHAQDCDVRGTLAIPVFEQGSKICLGVIEVV
MTTEMVKLRPELESICRALQAVDLRSTELPIPPSLKGCDLSYKAALPEIRNLLRCACETH
KLPLAQTWVSCQQQNKSGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHHLLKGQ
GVAGQAFLTNGPCFSSDVSNYKKSEYPLSHHANMYGLHGAVAIRLRCIHTGSADFVLEFF
LPKDCDDLEEQRKMLNALSTIMAHVPRSLRTVTDKELEEESEVIEREEIVTPKIENASEL
HGNSPWNASLEEIQRSNNTSNPQNLGLVFDGGDKPNDGFGLKRGFDYTMDSNVNESSTFS
SGGFSMMAEKKRTKADKTITLDVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPS
RKIKKVGHSLQKIQRVIDSVQGVSGPLPIGSFYANFPNLVSQSQEPSQQAKTTPPPPPPV
QLAKSPVSSYSHSSNSSQCCSSETQLNSGATTDPPSTDVGGALKKTSSEIELQSSSLDET
ILTLSSLENIPQGTNLLSSQDDDFLRIKVSYGEEKIRLRMRNSRRLRDLLWEIGKRFSIE
DMSRYDLKYLDEDNEWVLLTCDEDVEECVDVCRTTPSHTIKLLLQASSHHFPERSSATEY
SLWH

MENNSLPMDPAMDSSFMDGLLLEGCWLETTDASEFLNFSPSTSVAPFDPSSFMWSPTQDT
SNSLSQMYGQDCPERSSLEDQNQGRDLSTFNRRWWIGPSGHHGFSVMERLVQAVTHIKDF
TSERGSLIQLWVPVDRGGKRVLTTKEQPFSHDPMCQRLAHYREISENYQFSTEQEDSDSS
SRDLVGLPGRVFLGKVPEWTPDVRFFKNEEYPRVQHAQDCDVRGTLAIPVFEQGSQICLG
VIEVVMTTQMVKLSPDLESICRALQAVDLRSTEIPIPPSLKGPDFSYQAALPEIRNLLRC
ACETHKLPLAQTWVSCLKQSKTGCRHNDENYIHCVSTIDDACYVGDPTVREFHEACSEHH
LLKGQGVVGEAFLTNGPCFSSDVSSYKKSEYPLSHHATMFGLHGTVAIRLRCIHTGSVDF
VLEFFLPKNCRDIEEQRKMLNALSTIMAHVPRSLRTVTQKELEEEGDSMVSEVIEKGVTL
PKIENTTEVHQSISTPQNVGLVFDGGTTEMGELGSEYGKGVSVNENNTFSSASGFNRVTE
KKRTKAEKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKVGHS
LQKIQRVIDSVEGVSGHHLPIGSFYASFPNLAASPEASSLQQQSKITTFLSYSHSPPAKS
PGSSCSHSSSCSSETQVIKEDPTDKTRLVSRSFKETQTTHLSPSSQEDDFLRVKVSYEEE
KIRFKMRNSHRLKDLLWEIAKRFSIEDVSRYDLKYLDEDNEWVLLRCDDDVEECVDVCRS
FPGQTIKLLLQLSSSYLPERSSVSGCLS

www.000webhost.com

Other information
Ka divergence:-0.0282139KaKs divergence:-0.0563094
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):2535Length 2 (bp):2427Length divergence:-0.022
MFE 1 (kcal):-770.23MFE 2 (kcal):-718.97MFE divergence-0.034