Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20650-AT1G76370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase superfamily protein
Function (paralog2):Protein kinase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-3.8093191763214
Log2 mRNA fold difference:-5.5698596592722
Log2 TE fold difference:2.5177189035673
Sequences
Protein sequence

MTCCFSCLNPRTKDIRVDIDNARCNSRYQTDSSVHGSDTTGTESISGILVNGKVNSPIPG
GGARSFTFKELAAATRNFREVNLLGEGGFGRVYKGRLDSGQVVAIKQLNPDGLQGNREFI
VEVLMLSLLHHPNLVTLIGYCTSGDQRLLVYEYMPMGSLEDHLFDLESNQEPLSWNTRMK
IAVGAARGIEYLHCTANPPVIYRDLKSANILLDKEFSPKLSDFGLAKLGPVGDRTHVSTR
VMGTYGYCAPEYAMSGKLTVKSDIYCFGVVLLELITGRKAIDLGQKQGEQNLVTWSRPYL
KDQKKFGHLVDPSLRGKYPRRCLNYAIAIIAMCLNEEAHYRPFIGDIVVALEYLAAQSRS
HEARNVSSPSPEISRTPRRDL

MRCFSCLNTQTNDMRINIDTLSDLTDYASVATKIDPRGTGSKSGILVNGKVNSPKPGGGA
RSFTFKELAAATKNFREGNIIGKGGFGSVYKGRLDSGQVVAIKQLNPDGHQGNQEFIVEV
CMLSVFHHPNLVTLIGYCTSGAQRLLVYEYMPMGSLEDHLFDLEPDQTPLSWYTRMKIAV
GAARGIEYLHCKISPSVIYRDLKSANILLDKEFSVKLSDFGLAKVGPVGNRTHVSTRVMG
TYGYCAPEYAMSGRLTIKSDIYSFGVVLLELISGRKAIDLSKPNGEQYLVAWARPYLKDP
KKFGLLVDPLLRGKFSKRCLNYAISITEMCLNDEANHRPKIGDVVVAFEYIASQSKSYED
RRTARKSTDSNRLRRETKQSY

www.000webhost.com

Other information
Ka divergence:0.47KaKs divergence:-0.308832
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1146Length 2 (bp):1146Length divergence:0
MFE 1 (kcal):-332.3MFE 2 (kcal):-331.53MFE divergence-0.001