Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20670-AT1G76380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA-binding bromodomain-containing protein
Function (paralog2):DNA-binding bromodomain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0852423952889
Log2 mRNA fold difference:-0.083343425917105
Log2 TE fold difference:-1.1658724546341
Sequences
Protein sequence

MGEVADTMTKKKKKGRPSLLDLQKRAIKQQQQQLQQQQQQHKNNHQDDDDHHHNNNNRSG
SKNPNSLNHRSKRRNPNSNDGDSPWIKDEGEDNDDDERREKKHKLLHGLNSHSHRHSPNS
QSDLNLDQTPEPSFNRRNLSAAASGSDYHTGEKASKATDILQGSPVESGPTTPLPDKKLL
LFILDRLQKKDTYGVYSDPVDPEELPDYFEIIKNPMDFSTLRNKLDSGAYSTLEQFERDV
FLICTNAMEYNSADTVYYRQARAIQELAKKDFENLRQDSDDEEPQSQQQQQQQPKVARRG
RPPKKHPEPSSIDRTASEISADALIPGDSSNKFSGAYNLRKAPPSYKFRQAESSVRINHN
SETQSGWSVDWESEFPSSVVKAVNKYGMKHFNVDDNRRDTYNHLSTSTQEPSVLTTLEDE
LKQLIPVGLNMEYGYAKSLARYAANLGPVAWKIASRRIETVLPSGIKFGQGWVGENPAGP
EEDDSQKQNILMSSGKQKCSNDLASDDHSNRILSPTASVSSAFIGNRHASSQAIEETTPP
PARVLNPEIDHPSSSSHQAGLLIKTESSNGLIRGFNHNANQMLGIARQQQPNVSNEATPV
SQQQGSLFPYPKQEFHRFPPDLNARLVSPNSPGSNQQTGSSSSQHPDLALQL

MGEVADNNTLMKRKKKGRPSLLDLQKRALKQQQLLQRRNPNEENEEELRSSSRNPNFSNR
SNRRRNSNSEDDDDERRDKKHRLLHGLNSHEGRDSSNSKSGGGDLDSDARNRRKIDGSDN
TGEKASKATDILLQRGSLVESTPLPDKKLLFFILDRVQKKDTYGVYSDPADPEELPDYYE
IIKNPMDFTTLRKKLESGAYTTLEQFEQDVFLICTNAMEYNSADTVYYRQARAMLELAKK
DFGNLRQESDGEEPVSLSQQPKVVKRGRPPGSGLKKQLEQSLIDRTTSDISADAAAFTYA
GDSSRLSGSYNLRKNPPSYGFRHAETSVRINHNSENQSGLLIDWEKEFPPSVVKAVNKYG
MKNVDENRRDTYNQNSASLQDSSIFTLLDDNLKQLTPVGLKAEYGYARSLARYAANIGPV
AWTFANVRIEKLLPTGTEFGPGWVGENPENPPQQQNLMSGKQKCSNDYASDDHHQSSRIM
SPSTSVSSSIIGNIHSSHESKESVQVLNQETEINGLVRGSSGFNHKPNQMLETAGSQQGN
IKQEFQRLPPDLNARLSSPNSPGSNHQAGSSQHPDLALQL

www.000webhost.com

Other information
Ka divergence:0.490848KaKs divergence:0.0119332
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1959Length 2 (bp):1743Length divergence:-0.058
MFE 1 (kcal):-516.69MFE 2 (kcal):-495.84MFE divergence-0.021