Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20693-AT1G20696
Species:Arabidopsis
Duplication type:TD
Function (paralog1):high mobility group B2
Function (paralog2):high mobility group B3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.0349977837461
Log2 mRNA fold difference:-0.7599687683004
Log2 TE fold difference:-0.16216642938106
Sequences
Protein sequence

MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKEN
PKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEES
DKSVSEVNDEDDAEDGSEEEEDDD

MKGAKSKAETRSTKLSVTKKPAKGAKGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKN
KSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLVIALRKMRNLTSQ
FQRLTMRMMLRMAVKRRKTMIKKLKLW

www.000webhost.com

Other information
Ka divergence:0.666219KaKs divergence:0.363506
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):435Length 2 (bp):444Length divergence:0.01
MFE 1 (kcal):-115.9MFE 2 (kcal):-123.2MFE divergence0.031