Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20780-AT1G76390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):senescence-associated E3 ubiquitin ligase 1
Function (paralog2):ARM repeat superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.6738500906226
Log2 mRNA fold difference:0.18458018797387
Log2 TE fold difference:1.4742564724077
Sequences
Protein sequence

MVGSSDGDQSDDSSHFERGVDHIYEAFICPLTKEVMHDPVTLENGRTFEREAIEKWFKEC
RDSGRPPSCPLTSQELTSTDVSASIALRNTIEEWRSRNDAAKLDIARQSLFLGNAETDIL
QALMHVRQICRTIRSNRHGVRNSQLIHMIIDMLKSTSHRVRYKALQTLQVVVEGDDESKA
IVAEGDTVRTLVKFLSHEPSKGREAAVSLLFELSKSEALCEKIGSIHGALILLVGLTSSN
SENVSIVEKADRTLENMERSEEIVRQMASYGRLQPLLGKLLEGSPETKLSMASFLGELPL
NNDVKVLVAQTVGSSLVDLMRSGDMPQREAALKALNKISSFEGSAKVLISKGILPPLIKD
LFYVGPNNLPIRLKEVSATILANIVNIGYDFDKATLVSENRVENLLHLISNTGPAIQCKL
LEVLVGLTSCPKTVPKVVYAIKTSGAIISLVQFIEVRENDDLRLASIKLLHNLSPFMSEE
LAKALCGTAGQLGSLVAIISEKTPITEEQAAAAGLLAELPDRDLGLTQEMLEVGAFEKII
SKVFGIRQGDIKGMRFVNPFLEGLVRILARITFVFNKEARAINFCREHDVASLFLHLLQS
NGQDNIQMVSAMALENLSLESIKLTRMPDPPPVNYCGSIFSCVRKPHVVNGLCKIHQGIC
SLRETFCLVEGGAVEKLVALLDHENVKVVEAALAALSSLLEDGLDVEKGVKILDEADGIR
HILNVLRENRTERLTRRAVWMVERILRIEDIAREVAEEQSLSAALVDAFQNADFRTRQIA
ENALKHIDKIPNFSSIFPNIA

MAGSGSWDGSQSDNSSQFEPGIDNIYEAFICPLTKQVMHNPVTLENGQTFEREAIEKWFQ
ECRENGQPLSCPITSKELSITDLSPSIALRNTIEEWRARNDALKLDIARQSLYLGNAETN
ILLALKNVREICRNIRKIRQRVCNPQLVRLITDMLKSSSHEVRCKALQTLQVVVEGDEES
KAIVAEGDTVRTIVKFLSQEPSKGREAAVSVLFELSKSEALCEKIGSIHGAIILLVGLTS
SKSENVSTVEKADKTLTNLERSEENVRQMAINGRLQPLLAKLLEGSPETKVSMAFYLGVL
ALNNDVKVIVAQTVGSSLIDLMRTRDMSQREAALGALNNISSFEGSAKLLINTGILPPLI
KDLFYVGPNQLPIRLKEVSATILANIVNIGYDFDKVPVGPHHQTLVSEEIVENLLQLTSN
TGPEIQGKLLAVLVGLTSCPNSVINVVSAIRNSAAIISLVQFVEIHENDDLRLASIKLLH
NISPHMSEELANALRSTVGQLGSLVSIISENTPTITEEQAAAAGLLAELPERDLVLTMRL
LREGAFEKIISKIVGIRQGEIRGIRFERTFLEGLVSILARITFALTKETDATLFCCEKNL
PSLFLDLLQSNSQDNIQRASATALENLSLESKNLTKIPELPPPTYCVSIFSCLSKPPVVL
GICKIHQGICSVRESFCLVEGQAVDKLVDLLDHENDKVVGPALAALSTLLEDGLDVVQGV
RLIDEADGITPILNVLLENRTENLRIRAVWMVERILRIEEIAREVGEEQNVTAALVDAFQ
NADFRTRQIAEKALRHIDKIPNFSGIFTNIG

www.000webhost.com

Other information
Ka divergence:-0.0013712KaKs divergence:-0.090583
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):2406Length 2 (bp):2436Length divergence:0.006
MFE 1 (kcal):-773.62MFE 2 (kcal):-731.76MFE divergence-0.028