Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20816-AT1G76405
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.94793945356761
Log2 mRNA fold difference:-0.0037093152630165
Log2 TE fold difference:-0.95411941335917
Sequences
Protein sequence

METSLRYATNSRSLKIHAKEKFPVNSKTRLQLHGELDTGAGVPSYFCAMIRYFFHEASTN
LGVGLHYDKREKLRCLVRGKKKFPVITDEVVTFNIKGRCDFDQDLVQRNAKGAAEFDWNI
WKFQKDQDLRLRIGYEMFEKVPYMQIRENNWTFNTNLKGKWNVRYDL

METSMRYTSNSKSMKIHAKEKVPVNSKTHLQLHGELDTGTGAPSYFCAMIRHFFPEASTG
LGVGLHYDKRQKLRCLVRGKKEFPVRADKRVTFNIKGRCDIDQDLNQKNPKGAAEFAWNI
MDFKEDQDVRIKVGYEMFDKVPYMQIRENNWTLNANMKGKWNLRYDL

www.000webhost.com

Other information
Ka divergence:0.0439129KaKs divergence:-0.377857
GC content 1 (%):39GC content 2 (%):42GC content divergence:0.037
Length 1 (bp):504Length 2 (bp):504Length divergence:0
MFE 1 (kcal):-132.8MFE 2 (kcal):-136.1MFE divergence0.012