Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20823-AT1G76410
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.2811842076844
Log2 mRNA fold difference:0.63546983915323
Log2 TE fold difference:0.2748779894563
Sequences
Protein sequence

MARLLFRLLVESNTPSPAIDNSTAALNSDLVVILAALLCALICVLGLIAVSRCVWLRRLA
AGNRTVSGSQTQSPQPPVAAANKGLKKKVLQSLPKLTFSPESPESEKFAECAICLAEFSA
GDELRVLPQCGHGFHVACIDTWLGSHSSCPSCRQILVVARCHKCGGLPGSSSSGLESEPE
IEIRIKQGEDDPNSFLP

MARLLFRLLQEANSTSPAEASPPFNSDLVLILAVLLCALTCIIGLIAVSRCAWLRRIASR
NRSDQTHPPPVAAANKGLKKKVLRSLPKLTYSPDSPPAEKLVECAICLTEFAAGDELRVL
PQCGHGFHVSCIDTWLGSHSSCPSCRQILVVTRCHKCGGLPGSSSSGPEPDTRIKQREDG
PDNLP

www.000webhost.com

Other information
Ka divergence:0.234336KaKs divergence:-0.999874
GC content 1 (%):54GC content 2 (%):52GC content divergence:-0.019
Length 1 (bp):594Length 2 (bp):558Length divergence:-0.031
MFE 1 (kcal):-197.81MFE 2 (kcal):-174.37MFE divergence-0.063