Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20880-AT1G76460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RNA-binding (RRM/RBD/RNP motifs) family protein
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6670572490966
Log2 mRNA fold difference:2.2566212421357
Log2 TE fold difference:-0.62953531159896
Sequences
Protein sequence

MAYHSIPSSGFHYLNSPFGDTTFTKVFVGGLAWETQSETLRRHFDQYGDILEAVVITDKN
TGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLASLGRSRPPMQYAVIPHAPGRV
RPPSPYVGSVQSPRGLHFGSHPYHQPPTYNYQQGVVYPYGVTPYGPDYMYSQSQGFYGPY
MGQQYLQVYGVPGAVNSPGYQYGQLSHTIPGAHGYTAGQGYSHPGSHVLQLGATSPMSAI
QSPYPSPSAPTHQRVIVQTPPQYIQSSGSDQTTG

MAYQPVPGSGFHYLNSPFGDTTFTKVFVGGLAWETQSETLRQHFEQYGEILEAVVIADKN
TGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRPPLPYAVIPNMPGRL
RPASPYIGNVQGPRGSLIGNYPYQQPLPYNYQQGVVYPYGVTAYGPEYMYSQSQGLYSPY
MGQQYLQVYGVPGAVNSPVYQYGQLSQTIPNGHGYTAVQGYSVPGSHILQLGGPTVSTMT
TSSMPALQAPYPSGIPGPAPVQSHIIVHSPQFMQSTASDQTTSYS

Other information
Ka divergence:-0.482013KaKs divergence:-0.892221
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):825Length 2 (bp):858Length divergence:0.02
MFE 1 (kcal):-250.72MFE 2 (kcal):-254.24MFE divergence0.007