Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20900-AT1G76500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Predicted AT-hook DNA-binding family protein
Function (paralog2):Predicted AT-hook DNA-binding family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.5052536896214
Log2 mRNA fold difference:-2.9319556407069
Log2 TE fold difference:-0.55838106631568
Sequences
Protein sequence

MEGGYEQGGGASRYFHNLFRPEIHHQQLQPQGGINLIDQHHHQHQQHQQQQQPSDDSRES
DHSNKDHHQQGRPDSDPNTSSSAPGKRPRGRPPGSKNKAKPPIIVTRDSPNALRSHVLEV
SPGADIVESVSTYARRRGRGVSVLGGNGTVSNVTLRQPVTPGNGGGVSGGGGVVTLHGRF
EILSLTGTVLPPPAPPGAGGLSIFLAGGQGQVVGGSVVAPLIASAPVILMAASFSNAVFE
RLPIEEEEEEGGGGGGGGGGGPPQMQQAPSASPPSGVTGQGQLGGNVGGYGFSGDPHLLG
WGAGTPSRPPF

MDGGYDQSGGASRYFHNLFRPELHHQLQPQPQLHPLPQPQPQPQPQQQNSDDESDSNKDP
GSDPVTSGSTGKRPRGRPPGSKNKPKPPVIVTRDSPNVLRSHVLEVSSGADIVESVTTYA
RRRGRGVSILSGNGTVANVSLRQPATTAAHGANGGTGGVVALHGRFEILSLTGTVLPPPA
PPGSGGLSIFLSGVQGQVIGGNVVAPLVASGPVILMAASFSNATFERLPLEDEGGEGGEG
GEVGEGGGGEGGPPPATSSSPPSGAGQGQLRGNMSGYDQFAGDPHLLGWGAAAAAAPPRP
AF

Other information
Ka divergence:0.245133KaKs divergence:0.363765
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):936Length 2 (bp):909Length divergence:-0.015
MFE 1 (kcal):-332.3MFE 2 (kcal):-334.5MFE divergence0.003