Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20910-AT1G76510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ARID/BRIGHT DNA-binding domain-containing protein
Function (paralog2):ARID/BRIGHT DNA-binding domain-containing protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.030152558284746
Log2 mRNA fold difference:-0.083979611898315
Log2 TE fold difference:0.013405763047953
Sequences
Protein sequence

MVDTEMQEQDVTFGALVETKYLEEEPLEPENDHNPSEIPQPLLLGDGQANNGHGMNGGAV
GVVDHSERKTRRVQMLSPKTEGENAKKRKTWLLDSEAQGTDEAGTPVEQVAFLREVEAFY
KESFLEFKPPKFYGQPLNILKLWRAVVNLGGYEVVTTNKLWRQVGESFNPPKTCTTVSYT
FRNFYEKALLEYEKCLRNNGELNLPGSTLILSSSVEKEPSSHQGSGSGRARRDSAARAMQ
GWHAQRLVGSGEVTAPAVKDKGLISTPKHKKLKSIGLQKHKQQTSMDHVVTNEADKQLAA
EVVDVGPVADWVKINVKESKDSFEIFALVPGLLRKEVRIQSDPAGKVVITGQPEQLDNPW
GITPFKKIVDLSARIDPLHTSAVMSMHGRLFIRVPFEQ

MMADTEMQEQDVPSGTKGVVEEPSELEKDLNSIERPKSPVPEDTTHTLDSDVHLSDAPIA
NQIEANEEVGGQNSVDGRNGDVDQSEKKITSDGGQEETTLGESNPLKGDPSSPHVPEESV
KKWKTWLLSDAEAREVDEAGAPQDQEAFIKEVEAFNKENFLEFKAPKFYGQPLNCLKLWR
AVIKLGGYDVVTTSKLWRQVGESFHPPKTCTTVSWTFRIFYEKVNFIFGLSTEYALILMR
LYLFSLALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQG
WHSQRLLGSGEVTEPIVKEKGLNSTPKQKNLKNIGVQKQKTTTGMDLVFSHESEKQSTAE
VIDVGPPADWVKINVRETKDCFEIFALVPGLLREEVRVQSDPAGRLVIAGQPEQLDNPWG
ITPFKKVVNFPARIDPLHTSAVVSLHGRLFVRVPFEHREMNIDVPYKVSKEAVPYTFKYA
TNNHSVWYISFRK

www.000webhost.com

Other information
Ka divergence:-0.138919KaKs divergence:-0.457178
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1197Length 2 (bp):1482Length divergence:0.106
MFE 1 (kcal):-380.76MFE 2 (kcal):-461.33MFE divergence0.096