Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20930-AT1G76540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cyclin-dependent kinase B2;2
Function (paralog2):cyclin-dependent kinase B2;1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.1261917636847
Log2 mRNA fold difference:1.232818964843
Log2 TE fold difference:-0.099430639987752
Sequences
Protein sequence

MDNNGVKPAVSAMEAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTT
LREISILRMLARDPHIVRLMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIP
QNTVKCLMYQLCKGMAFCHGHGVLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKY
THEILTLWYRAPEVLLGATHYSTGVDMWSVGCIFAELVTKQAIFAGDSELQQLLRIFRLL
GTPNEEVWPGVSKLKDWHEYPQWKPLSLSTAVPNLDEAGLDLLSKMLEYEPAKRISAKKA
MEHPYFDDLPDKSSL

MDEGVIAVSAMDAFEKLEKVGEGTYGKVYRAREKATGKIVALKKTRLHEDEEGVPSTTLR
EISILRMLARDPHVVRLMDVKQGLSKEGKTVLYLVFEYMDTDVKKFIRSFRSTGKNIPTQ
TIKSLMYQLCKGMAFCHGHGILHRDLKPHNLLMDPKTMRLKIADLGLARAFTLPMKKYTH
EILTLWYRAPEVLLGATHYSTAVDMWSVGCIFAELVTNQAIFQGDSELQQLLHIFKLFGT
PNEEMWPGVSTLKNWHEYPQWKPSTLSSAVPNLDEAGVDLLSKMLQYEPAKRISAKMAME
HPYFDDLPEKSSL

www.000webhost.com

Other information
Ka divergence:-0.0131457KaKs divergence:0.207937
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):948Length 2 (bp):942Length divergence:-0.003
MFE 1 (kcal):-280.8MFE 2 (kcal):-281.01MFE divergence0