Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20950-AT1G76550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphofructokinase family protein
Function (paralog2):Phosphofructokinase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.24979175452239
Log2 mRNA fold difference:-0.60565609510954
Log2 TE fold difference:0.36352275546153
Sequences
Protein sequence

MDSDFGIPRELSPLQQLRSQYKPELPPCLQGTTVRVELGDGTTVAEAADSHTMARAFPHT
LGQPLAHFLRETAQVPDAHIITELPSVRVGIVFCGRQAPGGHNVIWGLFEALKVHNAKST
LLGFLGGSEGLFAQKTLEITDDILQTYKNQGGYDLLGRTKDQIKTTEQVNAALKACTDLK
LDGLVIIGGVISNTDAAHLAEFFAAAKCSTKVVGVPVTTNGDLKNQFVEANVGFDTICKV
NSQLISNACTDALSAEKYYYFIRLMGRKHSHVALECTLQSHPNMVILGEEVAASKLTIFD
IAKQICDAVQARAVEDKNHGVILIPEGLIVSIPEVYALLKEIHGLLRQGVSADKISTQLS
PWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHICYHILAAGLNGYMATVTNLKSPVNKWKCG
ATPITAMMTVKHWSQDASYTLTSIGRPAIHPAMVDLKGKAYDLLRQNAQKFLMEDLYRNP
GPLQYDGPGADAKAVSLCVEDQDYMGRIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMAS
VTDVLTTISSNGGQ

MDSDFGIPRELSPLQQLRSQYHPELPPCLQGTTVRVELGDGTTVAKAGDAHIIARAFPHT
LGQPLAHFLRATAKVADAQIITEHPVKRVGIVFCGRQAPGGHNVVWGLYEALKVHNAKNT
LLGFLGGSEGLFAQKTLEITDEVLQTYKNQGGYDMLGRTKDQIRTTEQVNAALKACTDLK
LDSLVIIGGVTSNTDAAHLAEFFAEAKCSTKVVGVPVTINGDLKNQFVEANVGFDTTCKV
NSQLISNICTDALSAEKYYYFVRLMGRKHSHVALECTLQSHPNMVILGEEVTASKLTIFD
IIKQICDAVQARAEQDKNHGVILIPEGLVESIPELYALLKEIHGLLKEGVQVDNISTQLS
SWSSALFEFLPPFIKKQLLLHPESDDSAQLSQIETEKLLAYLVETEMNKRLKEGTYKGKK
FNAICHFFGYQARGSLPSKFDCDYAYVLGHVCYHILAAGLNGYMATVTNLKSPVNKWKCG
AAPISAMMTVKRWSQNSGSTTIGRPVIHPASVDLKGKAYDLLRQNAQKFLMEDMYRNPGP
VQYDGPGADAKAVSLCVEDQDYMGKIKKLQEYLDQVRTIVKPGCSQDVLKAALSVMASVT
DVLTTISSSSTSGQQFA

Other information
Ka divergence:-0.0559116KaKs divergence:-0.198497
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1845Length 2 (bp):1854Length divergence:0.002
MFE 1 (kcal):-575.05MFE 2 (kcal):-580.5MFE divergence0.005