Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20980-AT1G76580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):squamosa promoter binding protein-like 14
Function (paralog2):Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.4058590302775
Log2 mRNA fold difference:-2.8388533029227
Log2 TE fold difference:0.37146383194554
Sequences
Protein sequence

MDEVGAQVAAPMFIHQSLGRKRDLYYPMSNRLVQSQPQRRDEWNSKMWDWDSRRFEAKPV
DVEVQEFDLTLRNRSGEERGLDLNLGSGLTAVEETTTTTQNVRPNKKVRSGSPGGNYPMC
QVDNCTEDLSHAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSC
RRRLAGHNRRRRKTTQPEEVASGVVVPGNHDTTNNTANANMDLMALLTALACAQGKNAVK
PPVGSPAVPDREQLLQILNKINALPLPMDLVSKLNNIGSLARKNMDHPTVNPQNDMNGAS
PSTMDLLAVLSTTLGSSSPDALAILSQGGFGNKDSEKTKLSSYENGVTTNLEKRTFGFSS
VGGERSSSSNQSPSQDSDSRGQDTRSSLSLQLFTSSPEDESRPTVASSRKYYSSASSNPV
EDRSPSSSPVMQELFPLQASPETMRSKNHKNSSPRTGCLPLELFGASNRGAADPNFKGFG
QQSGYASSGSDYSPPSLNSDAQDRTGKIVFKLLDKDPSQLPGTLRSEIYNWLSNIPSEME
SYIRPGCVVLSVYVAMSPAAWEQLEQKLLQRLGVLLQNSPSDFWRNARFIVNTGRQLASH
KNGKVRCSKSWRTWNSPELISVSPVAVVAGEETSLVVRGRSLTNDGISIRCTHMGSYMAM
EVTRAVCRQTIFDELNVNSFKVQNVHPGFLGRCFIEVENGFRGDSFPLIIANASICKELN
RLGEEFHPKSQDMTEEQAQSSNRGPTSREEVLCFLNELGWLFQKNQTSELREQSDFSLAR
FKFLLVCSVERDYCALIRTLLDMLVERNLVNDELNREALDMLAEIQLLNRAVKRKSTKMV
ELLIHYLVNPLTLSSSRKFVFLPNITGPGGITPLHLAACTSGSDDMIDLLTNDPQEIGLS
SWNTLRDATGQTPYSYAAIRNNHNYNSLVARKLADKRNKQVSLNIEHEVVDQTGLSKRLS
LEMNKSSSSCASCATVALKYQRRVSGSQRLFPTPIIHSMLAVATVCVCVCVFMHAFPIVR
QGSHFSWGGLDYGSI

MGELPKDDWQMNRWKWDGQRFEAIELQGESLQLSNKKGLDLNLPCGFNDVEGTPVDLTRP
SKKVRSGSPGSGGGGGGNYPKCQVDNCKEDLSIAKDYHRRHKVCEVHSKATKALVGKQMQ
RFCQQCSRFHLLSEFDEGKRSCRRRLDGHNRRRRKTQPDAITSQVVALENRDNTSNNTNM
DVMALLTALVCAQGRNEATTNGSPGVPQREQLLQILNKIKALPLPMNLTSKLNNIGILAR
KNPEQPSPMNPQNSMNGASSPSTMDLLAALSASLGSSAPEAIAFLSQGGFGNKESNDRTK
LTSSDHSATTSLEKKTLEFPSFGGGERTSSTNHSPSQYSDSRGQDTRSSLSLQLFTSSPE
EESRPKVASSTKYYSSASSNPVEDRSPSSSPVMQELFPLHTSPETRRYNNYKDTSTSPRT
SCLPLELFGASNRGATANPNYNVLRHQSGYASSGSDYSPPSLNSNAQERTGKISFKLFEK
DPSQLPNTLRTEIFRWLSSFPSDMESFIRPGCVILSVYVAMSASAWEQLEENLLQRVRSL
VQDSEFWSNSRFLVNAGRQLASHKHGRIRLSKSWRTLNLPELITVSPLAVVAGEETALIV
RGRNLTNDGMRLRCAHMGNYASMEVTGREHRLTKVDELNVSSFQVQSASSVSLGRCFIEL
ENGLRGDNFPLIIANATICKELNRLEEEFHPKDVIEEQIQNLDRPRSREEVLCFLNELGW
LFQRKWTSDIHGEPDFSLPRFKFLLVCSVERDYCSLIRTVLDMMVERNLGKDGLLNKESL
DMLADIQLLNRAIKRRNTKMAETLIHYSVNPSTRNFIFLPSIAGPGDITPLHLAASTSSS
DDMIDALTNDPQEIGLSCWNTLVDATGQTPFSYAAMRDNHSYNTLVARKLADKRNGQISL
NIENGIDQIGLSKRLSSELKRSCNTCASVALKYQRKVSGSRRLFPTPIIHSMLAVATVCV
CVCVFMHAFPMVRQGSHFSWGGLDYGSI

www.000webhost.com

Other information
Ka divergence:0.284345KaKs divergence:0.233301
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):3108Length 2 (bp):2967Length divergence:-0.023
MFE 1 (kcal):-987.48MFE 2 (kcal):-890.37MFE divergence-0.052