Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21000-AT1G76590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PLATZ transcription factor family protein
Function (paralog2):PLATZ transcription factor family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.6971312128523
Log2 mRNA fold difference:-1.3287057076469
Log2 TE fold difference:-0.35364509852647
Sequences
Protein sequence

MGPMIRTEEEEDYTSPPWLMPMLRGSYFVPCSIHVDSNKNECNLFCLDCAGNAFCSYCLV
KHKDHRVVQIRRSSYHNVVRVNEIQKFIDIACVQTYIINSAKIVFLNERPQPRIGKGVTN
TCEICCRSLLDSFRFCSLGCKLGGMRRGDLSLTFSLKGKHGREYLGGSESDEATTPTKMR
KTNAFNRLMSGLSISTVRFDDYGPNGDQRSSSSGDEGGFSFSPGTPPIYNHRNSSRRKGV
PHRAPF

MGPMMMRAEEDNYNLNPPPWLIPMLRANYFIPCSIHAASNKSECNMFCLDCSSEAFCSYC
LLNHRNHRVLQIRRSSYHNVVRVNEIQKYIDISCVQTYIINSARIVFLNERPQPRIGKGV
TNTCEICCRSLLDSFRFCSLGCKLGGMKRDPSLTFSLRGKHGREYEGEWESDEATTPTKI
RKTCAFNRLMSGLSISTVKCDYLSGDQPSSSSGDESGFKLSPGTPPIYNHRNSSRRKGVP
HRAPF

Other information
Ka divergence:0.214048KaKs divergence:-0.260918
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):741Length 2 (bp):738Length divergence:-0.002
MFE 1 (kcal):-216MFE 2 (kcal):-216.34MFE divergence0.001