Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21010-AT1G76600
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.5729534738252
Log2 mRNA fold difference:2.1775380177801
Log2 TE fold difference:-0.63540625940387
Sequences
Protein sequence

MGICVSFRREDSNSSPTVKIVTVNGDLREYNVPVIASQVLEAESAAAYSSSSSSRPSSYF
ICDSDSLYYDDFIPAIKSEEPLQADQIYFVLPISKRQSRLTASDMAALAVKASVAIQNSV
KKESRRRKKVRISPVMMLTGSNDSVNGNGSETTVKKGRPFVSKTAPVKASSGINRSGSVR
NLRRYTSKRAKLAVRSFRLKLSTIYEGSVV

MGLCVSVNRNEYVSSSTTAKIVTINGDLREYDVPVLASQVLESESTSSSSSSSSSSYFLC
NSDSLYYDDFIPAIESDEILQANQIYFVLPISKRQYRLSASDMAALAVKASVAIEKAAGK
KNRRRRSGRISPVVTLNQANDNRIAAVNNRIGGEATNMMMQKGKLPNRTTPFKDTNGYSR
SGSVRKLKRYTSGRAKLAVRSFRLRLSTIYEGSSFN

Other information
Ka divergence:0.316417KaKs divergence:0.65117
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):633Length 2 (bp):651Length divergence:0.014
MFE 1 (kcal):-212.8MFE 2 (kcal):-195.9MFE divergence-0.041