Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21050-AT1G76610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF617
Function (paralog2):Protein of unknown function, DUF617

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-5.4633689119834
Log2 mRNA fold difference:-4.6218744906104
Log2 TE fold difference:-0.31081048836892
Sequences
Protein sequence

MRTMVDLGKQRDHNYHHMQIITTPTSVDCSREFRHRRTLRSLIECMIPYCCTYQQQPYQN
DTLSVSSTSSSSSSSDHSSSSQSSSTVSGTFFGHRRGRVSFCLQDAAVGSSPLLLLELAV
PTAALAKEMDEEGVLRIALECDRRRSSNSRSSSIFDVPVWSMFCNGRKMGFAVRRKVTEN
DAVFLRMMQSVSVGAGVVPSEEEDQMLYLRARFERVTGSSDSESFHMMNPGGSYGQELSI
FLLRS

MRTIIDLGKQKSHLQIIDSPTNVDCTREVGLRRTLRSLMECVIPYCCTYQPPPTDQNDTV
SVSSSTSSSDQTGVVVTGTFYGHRRGHVSFCLQDDTRPSSPPLLLLELAVPTAALAREME
EGFLRIALRSKSNRRSSIFNVPVWSMYCNGRKFGFAVRRETTENDVGFLRLMQSVSVGAG
VIPNGETLYLRAKFERVTGSSDSESFHMVNQGGGYGQELSIFLSRS

Other information
Ka divergence:0.0518259KaKs divergence:0.0297749
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):738Length 2 (bp):681Length divergence:-0.04
MFE 1 (kcal):-232.2MFE 2 (kcal):-219.97MFE divergence-0.027