Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21060-AT1G76620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function, DUF547
Function (paralog2):Protein of unknown function, DUF547

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.3256222679379
Log2 mRNA fold difference:-1.3781432908134
Log2 TE fold difference:-0.0031083165218855
Sequences
Protein sequence

MMGLCSPSPSSHDCSSSSPRNSEKKQNVIVASPSRFSTYTKPSLSIEKRLLTYQDSNCNV
TPKSSEDLRKEIASLEFEILRTEQYLLSLYRTAFDEQVSSFSPHTETSLVSNQFLPKSEQ
SDVTSVFSYHYQASPASECSSLCPPRSFQASLKALSAREKSRYVSSSHTTLGDLLGSTLI
VDNIANPSRLSEDILRCICSVYCTLSSKARINSCLQASPSSPSSVSSKATFDSLNSRHEE
RKEANVPGVVVIESLELHLDDGSFNHAAVMLQNFRSLVQKLEKVDPSRMKREEKLAFWIN
IHNALTMHAYLAYGTHNRARNTSVLKAAYDVGGYSVNPYIIQSSILGIRPHFSQPLLQTL
FSPSRKSKTCNVKHIYALEYPEALAHFALSSGFSTDPPVRVYTADCVFRDLRKSKEEFIR
NNVRIHNETKILLPKIVHYYAKDMSLEPSALMETTVKCLPDSTKRTAQKLLKKKSRNIEY
SPENSSFRYVIIQEPTTRRHDSTII

MMALMNCAYSSSSSSSSTSSPTSSSSSSSYSPRNRESMFLQSVVDASPSSFSSDRKSILP
IEKTLIRHQNSSLCLIPKSSEELKKEIASIEIEILHMERYLLSLYRKSFEQQLPNSFSNL
SVTTTLPRSVTTSPTSLTHYQAYQKPISYPRSFNTSLKALSSREGTRVVSGTHSLGELLG
SSHIVDHNNFINPNKLSEDIMRCISSVYCTLSRGSTSTTSTCFPASPVSSNASTIFSSKF
NYEDKWSLNGASEDHFLNHCQDQDNVLPCGVVVIEALRVHLDDGSFGYAALMLQNFRSLV
QNLEKVDPSRMKREEKLAFWINIHNALVMHAYLAYGTHNRARNTSVLKAAYDIGGYRINP
YIIQSSILGIRPHYTSPSPLLQTLFSPSRKSKTCSVRHIYALEYPEALAHFAISSGAFTD
PTVRVYTADRIFRDLRQAKQEYIRSNVRVYKGTKILLPKIFQHYVKDMSMDVSKLMEATS
QCLPEDARKIAEKCLKEKKSKNFEWLPENLSFRYVIAGELVGARNKT

www.000webhost.com

Other information
Ka divergence:0.04318KaKs divergence:-0.189706
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):1518Length 2 (bp):1584Length divergence:0.021
MFE 1 (kcal):-397.13MFE 2 (kcal):-407.27MFE divergence0.013