Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21070-AT1G76670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-sugar transporter family protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.5971183038867
Log2 mRNA fold difference:3.2408025367622
Log2 TE fold difference:-1.5485663344715
Sequences
Protein sequence

MEKAENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL
VGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV
MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSL
QKKYSIGSFELLSKTAPIQAISLLIFGPFVDYFLSGRFISTYKMTYSAMLCILLSCALAV
FCNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLIFDSEMTFKNIAGMVLAVVGMVIYS
WAVELEKQRKSKVIPHGKHSMTEDEIKLLKEGIEHMDLKDMELGNNKA

MEKPESEKKSAVSDVGAWAMNVISSVGIIMANKQLMSSSGFGFGFATTLTGFHFAFTALV
GMVSNATGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVL
EWILHSKHYCKEVKASVMVVVIGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQ
KKYSVGSFELLSKTAPIQAISLLICGPFVDYLLSGKFISTYQMTYGAIFCILLSCALAVF
CNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSEMTFKNIAGMAIAIVGMVIYSW
AVDIEKQRNAKSTPHGKHSMTEDEIKLLKEGVEHIDLKDVELGDTKP

www.000webhost.com

Other information
Ka divergence:0.0284792KaKs divergence:0.387228
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1047Length 2 (bp):1044Length divergence:-0.001
MFE 1 (kcal):-291.94MFE 2 (kcal):-308.45MFE divergence0.027