Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21080-AT1G76700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNAJ heat shock N-terminal domain-containing protein
Function (paralog2):DNAJ heat shock N-terminal domain-containing protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.99881426705505
Log2 mRNA fold difference:-1.1679770672657
Log2 TE fold difference:0.34295627793289
Sequences
Protein sequence

MVKETEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD
PGQRQAYDTSGKSGISTEIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGDQID
TKKIIEKMRAVQKEREDKLAQILKDRLNLYMTNKDEFTSNAEAEVTRLSNAAYGVEMLNT
IGYIYVRQAAKELGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKRQL
SAEGNYTEKELEEYMKTHKKVMIDSLWKLNVADIESTISRVCEQVLQDPTAKREELRARA
KGLKTLGKIFQKNKIASESDPLVRAELHKLNGNGQEHDHSSTSPKSDEASRSTVGPQPEV
ETVSLVEPQSPYVEAPKLGEEQINYYFPRPAPPPGAQRHS

MVKETEYYDVLGVSPTATESEIKKAYYIKARQVHPDKNPNDPQAAHNFQVLGEAYQVLSD
SGQRQAYDACGKSGISTDAIIDPAAIFAMLFGSELFEGYIGQLAMASMASLDIFTEGDQF
DTKKIQEKLRIVQKEREDKLAQILKDRLNEYVINKDEFISNAEAEVARLSNAAYGVDMLN
TIGYIYVRQAAKELGKKAIYLGVPFIAEWFRNKGHFIKSQLTAATGAYALFQLQEEMKRQ
LNTEGNYTEEELEEYLQAHKRVMIDSLWKLNVADIEATLCRVCQLVLQDPEAKREELRTR
ARGLKALGRIFQRAKTASESDPLENSEPQKLNGNGKNHDEDTSTSPKSSEASHSTSGPQE
PQSPYVEEFKLGDEQFNYYFPRPAPPPGAGKYSSSGYD

Other information
Ka divergence:0.0952354KaKs divergence:-0.143554
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1203Length 2 (bp):1197Length divergence:-0.003
MFE 1 (kcal):-339.7MFE 2 (kcal):-339.45MFE divergence0