Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21140-AT1G76800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Vacuolar iron transporter (VIT) family protein
Function (paralog2):Vacuolar iron transporter (VIT) family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.065889234100065
Log2 mRNA fold difference:-0.5938676473738
Log2 TE fold difference:0.33746183145341
Sequences
Protein sequence

MESHNVSNSLNLDMEMDQEKAFDYSKRAQWLRAAVLGANDGLVSTASLMMGVGAVKQDVK
VMILSGFAGLVAGACSMAIGEFVSVYSQYDIEVAQMKRENGGQVEKEKLPSPMQAAAASA
LAFSLGAIVPLMAAAFVKDYHVRIGAIVAAVTLALVMFGWLGAVLGKAPVFKSSARVLIG
GWLAMAVTFGLTKLIGTHSL

MDQSGSNTNMDIEKESTTFDYSKRSQWLRAAVLGANDGLVSTASLMMGVGAVKHDVKAMI
LSGFAGMVAGACSMAIGEFVSVYSQYDIEVAQMERDSVEIEKEKLPSPMQAAAASALAFS
AGAIVPLLAAAFVKEYKMRIISVVVAVTVALMVFGWLGAALGKAPAVRSSARVLFGGWLA
MAVTFGLTKLIGLYGL

www.000webhost.com

Other information
Ka divergence:0.193284KaKs divergence:0.70939
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):603Length 2 (bp):591Length divergence:-0.01
MFE 1 (kcal):-206.43MFE 2 (kcal):-199.8MFE divergence-0.016