Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21170-AT1G76850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Exocyst complex component SEC5
Function (paralog2):exocyst complex component sec5

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4865199472849
Log2 mRNA fold difference:0.87782900588921
Log2 TE fold difference:0.49564619032883
Sequences
Protein sequence

MSSSDDLDEDELLQMALKEQSQRDVTYQKPPSANSRKPVTNLVQQPRRQKRAAAPPSKGG
AKASRKPSMDEDDESEVELLSISSGDEDEGNDRGRGGGGDGGGGRGRGGSGKERGRARKE
DDRAWDGVEPDCWKRVNEAELARKVRDMRESRTAPSVTQNLDRKVSGADKKVVLTSLQSF
PRGMECIDPLKLGIIDNKTLRLITESSESLSKAEKVDNALREKLVYTSDHFDPKLFISRI
HQETSAADLESGALALKSDLKGRNLQRKQLVKDNFDCFVSCKTTIDDIESKLKRIEDDPD
GSGTTHLFNCMKSVTSRANRAFEPLFERQAQAEKIRSVQGMLQRFRTLFNLPSIIRSSIS
KGEYDLAVREYKKAKSIALPSHVNLLKRVLEEVEKVMQEFKGTLYRSMEDPKIDFTSLEN
TVRLLLELEPESDPVWHYLNVQNHRIHGMLEKCTFDHEARMEILRNQVHERALSDAKWRQ
IQQNGVQLSDDTSSMEDNQVQVDQPLEESARREKDALRGRYIKILTAVIVYHLPTFWKTA
LSVFTGKFAKSSQVNDTSASKAEEKAEEARYSSHSLEEIAGMIRNTISVYEAKVQSTFHD
FDESYILHPYMSDTIKEVSKACQAFEAKESAPHSAVMALRKVKVEITKIYIQRLCSWMRA
STEEISKEETWIPVSILERNRSPYSISYLPLAFRSIIVSGMEQINMMILSLKGEAARSED
MFAHIEEILISVRLAFLNCFLDFAAHLEQIGADLSQRTTKRESWQNGYSNDHQEEQSINA
PESVVDPHRQLLMILSNIGYCKDELASELYNKYKYTWLQSRRNDEDISDLQDLMMSFSGL
GEKVLEHYTFAKANLIRTAATNYLLDSGIQWGAAPPVKGIRDAAVELLHTLVAVHAEVFA
GAKPLLDKILGTLVEGLIDTFLSLLDENRSDDLSSIDANGFCQLMLELEYFETILKPYLT
VDATESLKSLQGAVLEKAIESISETVENNPGGHQRKPTRGSEDAISDDKQSSVSPDDLLA
LAQQCTSGMLQLELEKTRLNSACFIETIPLDPVPPVAKAAYSRTSTDSPSRNYRESQPMG
SPVQARPRRR

MSSDSNDLDEDELLQMALKEQAKRDLTYQKPPSSSARKPVANLVQQPRQQKPVAAAAAPP
KKSAAAVRKPSMDEDEESEVELLSISSGDDDLEREREIGGSSGGAGRGRGSDVREKGRAR
KEDDGAWDGGEPDCWKRVNEAELARRVRDMRESRTAPVVQKVEGKAPAPGKKVALTSLQS
LPRGMECIDPLKLGIIDNKTLRLITESSGSPSKAEKVDNTLREKLVYFSDHFDPKLFLSR
IHQDTTAADLEAGALGLKSDLKGRNLQRKQLVKDNFDCFVSCKTTIDDIESKLKRIEEDP
EGSGTTHLFNCMKSVTSRANLAFEPLFERQAQAEKIRSVQGMLQRFRTLFNLPSIIRSSI
SKGEYDLAVREYKKAKSIALPSHVNILKRVLEEVEKVMLEFKGTLYKSMEDPKIDFTSLE
NTVRLLLELEPESDPVWHYLNVQNHRIHGLLEKCTYDHEARVEILRNDTHEKAISDAKWQ
QIQQNGVSYSDTASSNENNAVQVDLQSVEFPSEEIDILKGRYIKRLTAVLVHHIPVFWKT
AISIFSGKFAKSSQVTDTSANKAEEKVTEARYSTHSLEEVAGMIRKTISVYEAKVNSTFC
DFDESCILRPFMSDAINEVSKACQAFEAKESTPHSAVVALRKIQAEITKIYIQRLCSWMR
ASTEGISKEETWIPVSILERNRSPYAISYLPLAFRSVIVSGMEQVNLMILSVKSEAAKSE
DMFAQIEEIIISVRLAFLNCFLDFAAHLEQIGADLSQSTSRQDNWKNGYSDEHQEEPSAN
TYGSVIDPHRRLLMVLSNIGYCKDELASELYNKFKYTWLQSRDKNEDSSDLQDLIMSFSG
LGEKVLEHYTFAKANLIRTAATNYLLDSGIQWGSAPQVKGIRDAAVELLHTLVAVHAEVF
AGAKPLLDKILGVLIEGLIDTFLSVVEENRSSDLRSIDANGFCQLMFELEYFETVLYSYF
TSAATESLKSLQGTVLEIAIESISEAVETPGHNRRPTRGSEDTVSDDKQSVSADDLLALT
KQCSNELLQQELERTRVNTACFAESAPLESTPPLPKATYSSFRGSMDSPSRNYRGSQSSG
SPINARPRRR

www.000webhost.com

Other information
Ka divergence:-0.0276217KaKs divergence:-0.118118
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3273Length 2 (bp):3273Length divergence:0
MFE 1 (kcal):-1009.65MFE 2 (kcal):-1016.73MFE divergence0.003