Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21190-AT1G76860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Small nuclear ribonucleoprotein family protein
Function (paralog2):Small nuclear ribonucleoprotein family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.27352092722422
Log2 mRNA fold difference:-0.96715233993961
Log2 TE fold difference:1.1691212258865
Sequences
Protein sequence

MSVEEDATVREPLDLIRLSIEERIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIE
IDDETYEEIVRTTKRTVPFLFVRGDGVILVSPPLRTT

MSGEEEATVREPLDLIRLSLDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVE
IDDETYEEIVRTTKRTIEFLFVRGDGVILVSPPLRTAA

www.000webhost.com

Other information
Ka divergence:-0.252764KaKs divergence:0.999871
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):294Length 2 (bp):297Length divergence:0.005
MFE 1 (kcal):-83.1MFE 2 (kcal):-92.5MFE divergence0.054