Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21200-AT1G76870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sequence-specific DNA binding transcription factors
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.78635091483817
Log2 mRNA fold difference:-1.2626497804014
Log2 TE fold difference:0.46403210039282
Sequences
Protein sequence

MDGNFPQGGVVRSGASSYGGFDLQGSMRVHHQDSMNQQHRHNPNSRPLHEGLPFTMVTGQ
TCDHHQNQNMSMSEQQKAEREKNSVSDDDEPSFTEEGGDGVHNEANRSTKGSPWQRVKWT
DKMVKLLITAVSYIGDDSSIDSSSRRKFAVLQKKGKWKSVSKVMAERGYHVSPQQCEDKF
NDLNKRYKKLNDMLGRGTSCQVVENPALLDSIGYLNDKEKDDVRKIMSSKHLFYEEMCSY
HNGNRLHLPHDLALQRSLQLALRSRDDHDNDDSRKHQMEDLDDEDHDGDGDEHDEYEEQH
YAYGDCRVNHYGGGGGPLKKIRPSLSHEDGDHPSHVNSLECNKVSLPQIPFSQADVNQGG
AESGRAGSVQKQWMESRTLQLEEQKLQIQVELLELEKQRFRWQRFSKKRDQELERMRMEN
ERMKLENDRMGLELKQRELGVEL

MEGNCSQGRFDSQVSSMRDLRPNAINQNQKQHHPNSRQDSGFNNTMDTRHNNVDRGKKSM
SEDDELCLLSSDGQNKSKENSPWQRVKWMDKMVKLMITALSYIGEDSGSDKKFAVLQKKG
KWRSVSKVMDERGYHVSPQQCEDKFNDLNKRYKKLNEMLGRGTSCEVVENPSLLDKIDYL
NEKEKDEVRRIMSSKHLFYEEMCSYHNGNRLHLPHDPAVQRSLHLITLGSRDDHDNDEHG
KHQNEDLDDDDDYEEDHDGALSDRPLKRLRQSQSHEDVGHPNKGYDVPCLPRSQADVNRG
ISLDSRKAAGLQRQQIESKSLELEGRKLQIQAEMMELERQQFKWEVFSKRREQKLAKMRM
ENERMKLENERMSLELKRIELGAKL

www.000webhost.com

Other information
Ka divergence:0.370503KaKs divergence:0.239988
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):1332Length 2 (bp):1158Length divergence:-0.07
MFE 1 (kcal):-390.47MFE 2 (kcal):-312.71MFE divergence-0.111