Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21380-AT1G76970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Target of Myb protein 1
Function (paralog2):Target of Myb protein 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.3499386644018
Log2 mRNA fold difference:-2.6084703242625
Log2 TE fold difference:0.23666704454168
Sequences
Protein sequence

MANNAAACAERATNDMLIGPDWAINIELCDIINMEPSQAKEAVKVLKKRLGSKNSKVQIL
ALYALETLSKNCGESVYQLIVDRDILPDMVKIVKKKPDLTVREKILSLLDTWQEAFGGSG
GRFPQYYNAYNELRSAGIEFPPRTESSVPFFTPPQTQPIVAQATASDEDAAIQASLQSDD
ASALSMEEIQSAQGSVDVLTDMLGALDPSHPEGLKEELIVDLVEQCRTYQRRVMALVNTT
SDEELMCQGLALNDNLQRVLQHHDDKAKGNSVPATAPTPIPLVSINHDDDDDESDDDFLQ
LAHRSKRESARGTGQGNFNPILPPPPSSMRPVHVDSGAMDFLSGDVYKPQETFENVKPPS
TSQSSNHDYSAPIFDEPVPQSKSPEHALFTKPVYDQTEQLPPAPWETQEPRKYPPSMSAR
TNKRPEYFQHNVPQHSSSASESSYDDLLGQSRNLSLNPTASAAPVTPPKKDDKPEDILFK
DLMDFAKTRTSSSSSSKPNNQNNKPF

MANDAAACAERATNDMLIGPDWAINIELCDLINMDPSQAKEAVKVLKKRLGSKNSKVQIL
ALYALETLSKNCGENVYQLIIDRGLLNDMVKIVKKKPELNVREKILTLLDTWQEAFGGRG
GRYPQYYNAYNDLRSAGIEFPPRTESSLSFFTPPQTQPDEDAAIQASLQGDDASSLSLEE
IQSAEGSVDVLMDMLGAHDPGNPESLKEEVIVDLVEQCRTYQRRVMTLVNTTTDEELLCQ
GLALNDNLQHVLQRHDDIANVGSVPSNGRNTRAPPPVQIVDINHDDEDDESDDEFARLAH
RSSTPTRRPVHGSDSGMVDILSGDVYKPQGNSSSQGVKKPPPPPPHTSSSSSSPVFDDAS
PQQSKSSEVIRNLPPPPSRHNQRQQFFEHHHSSSGSDSSYEGQTRNLSLTSSEPQKEEKP
EDLLFKDLVEFAKTRSSKANNNNRSL

www.000webhost.com

Other information
Ka divergence:0.0292118KaKs divergence:0.180688
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1521Length 2 (bp):1341Length divergence:-0.063
MFE 1 (kcal):-423.76MFE 2 (kcal):-404.64MFE divergence-0.023