Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21390-AT1G76980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):embryo defective 2170
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.51746072252843
Log2 mRNA fold difference:0.2630964033698
Log2 TE fold difference:0.3161036828315
Sequences
Protein sequence

MLDPSSAKSFNTHLCFPSIPNDDHSDSGVCSPTLWRTSPPKSPPPFHRPEDYWSLSPDSK
AQAIARGQRELMEMVSKMPESCYELSLKDLVEVKVNQENERKVFDELPKRANRQSKVVRK
TKSDKRVDPNRSGGGNNSGFLLKIMFLVSLGAMKDTTKKKKKKKKDEACKVSPRPSISEE
TVKVEDKEWWNRMSESSTKRSGSSSSNNSIRSRSSLRDEKSSCFSFLTFKKLIPQYLKQR
FIGLRSRA

MAIFDLSSKSFDSHLNFPRTFDDHSDSGVCSPPLWRTSPPKSPAHLHNNYQNLSPVTKAQ
VIARGQRELMDMVSKMPESCYELSLKDLVEVNTEEEKVFDEMPQREKKPRKVVRKTKSDK
WVDPIRNGGVNNSGFLLKLVFPVSLGAKKKTNKKKDNDDDDSSVTSKRSWISSPRPSISD
LSMKREDKDWWKDGLSESRRSQSVVSRINSGSSKSSGGSSSRSNSDRSRNSLRYPQTLAN
LFRNPLRCFASSSRICFF

www.000webhost.com

Other information
Ka divergence:-0.0399551KaKs divergence:-0.999718
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):747Length 2 (bp):777Length divergence:0.02
MFE 1 (kcal):-215.74MFE 2 (kcal):-219.5MFE divergence0.009