Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21410-AT1G77000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):F-box/RNI-like superfamily protein
Function (paralog2):RNI-like superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.94949568926979
Log2 mRNA fold difference:-0.73871709956336
Log2 TE fold difference:-0.19132679100581
Sequences
Protein sequence

MVMGGEASMELDQCFQKMKMEGISIKEWKDIPVELLMRILSLVDDRNVIVASGVCTGWRD
AISFGLTRLRLSWCNNNMNSLVLSLVPKFVKLQTLNLRQDKPQLEDNAVEAIANHCHELQ
ELDLSKSLKITDRSLYALAHGCPDLTKLNLSGCTSFSDTAIAYLTRFCRKLKVLNLCGCV
KAVTDNALEAIGNNCNQMQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCGCVLITDESV
VALADWCVHLRSLGLYYCRNITDRAMYSLAQSGVKNKPGSWKSVKKGKYDEEGLRSLNIS
QCTALTPSAVQAVCDSFPALHTCSGRHSLVMSGCLNLTTVHCACILQAHRAHNAVPHPAH

MVSEGATRKELNLCFENMKMEGVLISEWKDIPVELLMKILNLVDDRTVIIASCICSGWRD
AVSLGLTRLSLSWCKKNMNSLVLSLAPKFVKLQTLVLRQDKPQLEDNAVEAIANHCHELQ
DLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHLTRFCRKLKILNLCGCV
EAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESV
VALANRCIHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRAVKKGKFDEEGLRSLNIS
QCTYLTPSAVQAVCDTFPALHTCSGRHSLVMSGCLNLQSVHCACILQAHRTHTVYPHPAH

www.000webhost.com

Other information
Ka divergence:0.167854KaKs divergence:-0.190296
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1083Length 2 (bp):1083Length divergence:0
MFE 1 (kcal):-339MFE 2 (kcal):-319.17MFE divergence-0.03