Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21440-AT1G77060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoenolpyruvate carboxylase family protein
Function (paralog2):Phosphoenolpyruvate carboxylase family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.71448603632474
Log2 mRNA fold difference:-0.094056333050754
Log2 TE fold difference:-0.60542700461813
Sequences
Protein sequence

MSMLMAAKSTSLFSSNPTISAKIGQNPRGVRSVYPTVRMQSRVHRLIEEQGAVLIPGVYD
ALSAAIVQQTGFSAALISGYALSAVTLGKPDFGLITPPEMAATARSVCAAAPKIPIIADA
DTGGGNALNVQRTVKDLIAAGAAGCFLEDQAWPKRCGHMRGKEVIPAEEHAAKIASARDA
IGDADFFLIARTDARALSAKTGLSDAIDRANLYMEAGADASFVEAPRDDDELKEIGRRTK
GYRLCNMLEGGRTPLHTPDELKEMGFHLIAHPLTSLYASTRALVDVLKILKEKGTTKDHL
EKMITFEEFNRLVNLDSWYELETKYSNLRNALGETK

MSMLMAVKTTSLCCSSLNLTASPTFRRNPRAARLVNPTARIQTRFHRLIEEQGIVLMPGC
YDALSAAIVQQTGFSAGFISGYALSASLLGKPDFGLLTPPEMAATARSVCASAPNIPIIA
DADTGGGNALNIQRTVKDLIAAGAAGCFLEDQAWPKKCGHMRGKQVIPAEEHAAKIASAR
DAIGDSDFFLVARTDVRATSAKSGLEDAIARVNLYMEAGADASFVEAPRDDDELKEIGKR
TKGYRVCNMIEGGVTPLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRD
HLQKMATFEEFNSLVDLDSWFELEARYSNLRNALGTTKS

www.000webhost.com

Other information
Ka divergence:-0.53993KaKs divergence:-0.722838
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1011Length 2 (bp):1020Length divergence:0.004
MFE 1 (kcal):-328.43MFE 2 (kcal):-315.41MFE divergence-0.02