Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21530-AT1G21540
Species:Arabidopsis
Duplication type:TD
Function (paralog1):AMP-dependent synthetase and ligase family protein
Function (paralog2):AMP-dependent synthetase and ligase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.4909479471858
Log2 mRNA fold difference:3.3973493674126
Log2 TE fold difference:-2.0928038346032
Sequences
Protein sequence

MELLLPHPSNSTPLTVLGFLDRAASVYGDCPSILHTANTVHTWSETHNRCLRIASALTSS
SIGIKQGQVVSVVGPNVPSVYELQFAVPMSGAILNNINPRLDAHALSVLLRHSESRLVFV
DHRSISLVLEAVSLFTQHEKPHLVLLDDDQENDSSSASDFLDTYEEIMERGNSRFKWIRP
QTEWQPMVLNYTSGTTSSPKGVVLSHRAIFMLTVSSLLDWSVPNRPVYLWTLPMFHANGW
GYTWGTAAVGATNICTRRVDAPTIYNLIDKHNVTHMCAAPMVLNMLINYPLSTPLKNPVQ
VMTSGAPPPATIISRAESLGFNVSHSYGLTETSGPVVSCAWKPKWDHLDPLERARLKSRQ
GVRTLGFTEVDVRDRKTGKSVKHDGVSVGEIVFRGSSVMLGYYKDPQGTAACMREDGWFY
SGDIGVIHKDGYLEIKDRSKDVIICGGENISSAEIETVLYTNPVVKEAAVVAKPDKMWGE
TPCAFVSLKCDNNGDGSVPVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTGKIQKFL
LRQMAKTLS

MELLLPHPSNSTPLTVLGFLDRAASVYGDCPSILHTTNTVHTWSETHNRCLRIASALTSS
SLGINRGQVVSVVGPNVPSVYELQFAVPMSGAILNNINPRLDAHALSVLLRHSESKLVFV
DPNSISVVLEAVSFMRQNEKPHLVLLDDDQEDGSLSPSAASDFLDTYQGVMERGDSRFKW
IRPQTEWQPMILNYTSGTTSSPKGVVLSHRAIFMLTVSSLLDWHFPNRPVYLWTLPMFHA
NGWGYTWGTAAVGATNVCTRRVDAPTIYDLIDKHHVTHMCAAPMVLNMLTNYPSRKPLKN
PVQVMTAGAPPPAAIISRAETLGFNVGHGYGLTETGGPVVSCAWKAEWDHLDPLERARLK
SRQGVRTIGFAEVDVRDPRTGKSVEHDGVSVGEIVLKGGSVMLGYYKDPEGTAACMREDG
WFYSGDVGVIHEDGYLEVKDRSKDVIICGGENISSAEVETVLYTNPVVKEAAVVAKPDKM
WGETPCAFVSLKYDSNGNGLVTEREIREFCKTRLPKYMVPRKVIFQEELPKTSTGKIQKF
LLRQMAKSLP

www.000webhost.com

Other information
Ka divergence:-0.120942KaKs divergence:-0.846295
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1650Length 2 (bp):1653Length divergence:0.001
MFE 1 (kcal):-514.99MFE 2 (kcal):-540.76MFE divergence0.024