Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21530-AT1G77240
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AMP-dependent synthetase and ligase family protein
Function (paralog2):AMP-dependent synthetase and ligase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.86155259410745
Log2 mRNA fold difference:2.9615109012148
Log2 TE fold difference:-3.9514254293474
Sequences
Protein sequence

MELLLPHPSNSTPLTVLGFLDRAASVYGDCPSILHTANTVHTWSETHNRCLRIASALTSS
SIGIKQGQVVSVVGPNVPSVYELQFAVPMSGAILNNINPRLDAHALSVLLRHSESRLVFV
DHRSISLVLEAVSLFTQHEKPHLVLLDDDQENDSSSASDFLDTYEEIMERGNSRFKWIRP
QTEWQPMVLNYTSGTTSSPKGVVLSHRAIFMLTVSSLLDWSVPNRPVYLWTLPMFHANGW
GYTWGTAAVGATNICTRRVDAPTIYNLIDKHNVTHMCAAPMVLNMLINYPLSTPLKNPVQ
VMTSGAPPPATIISRAESLGFNVSHSYGLTETSGPVVSCAWKPKWDHLDPLERARLKSRQ
GVRTLGFTEVDVRDRKTGKSVKHDGVSVGEIVFRGSSVMLGYYKDPQGTAACMREDGWFY
SGDIGVIHKDGYLEIKDRSKDVIICGGENISSAEIETVLYTNPVVKEAAVVAKPDKMWGE
TPCAFVSLKCDNNGDGSVPVTEREIREFCKTKLPKYMVPRKVIFQEELPKTSTGKIQKFL
LRQMAKTLS

MELLLPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSETHSRCLRIASTLSSAS
LGINRGQVVSVIGPNVPSVYELQFAVPMSGAVLNNINPRLDAHALSVLLRHSESKLVFVD
HHSSSLVLEAVSFLPKDERPRLVILNDGNDMPSSSSADMDFLDTYEGFMERGDLRFKWVR
PKSEWTPMVLNYTSGTTSSPKGVVHSHRSVFMSTINSLLDWSLPNRPVYLWTLPMFHANG
WSYTWATAAVGARNICVTRVDVPTIFNLIDKYQVTHMCAAPMVLNMLTNHPAQKPLQSPV
KVMTAGAPPPATVISKAEALGFDVSHGYGMTETGGLVVSCALKPEWDRLEPDERAKQKSR
QGIRTAVFAEVDVRDPISGKSVKHDGATVGEIVFRGGSVMLGYYKDPEGTAASMREDGWF
YTGDIGVMHPDGYLEVKDRSKDVVICGGENISSTELEAVLYTNPAIKEAAVVAKPDKMWG
ETPCAFVSLKYHDGSVTEREIREFCKTKLPKYMVPRNVVFLEELPKTSTGKIQKFLLRQM
AKSLP

www.000webhost.com

Other information
Ka divergence:0.117714KaKs divergence:0.0434035
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1650Length 2 (bp):1638Length divergence:-0.004
MFE 1 (kcal):-514.99MFE 2 (kcal):-537.75MFE divergence0.022