Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21590-AT1G77280
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein kinase protein with adenine nucleotide alpha hydrolases-like domain
Function (paralog2):Protein kinase protein with adenine nucleotide alpha hydrolases-like domain

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.8626406717058
Log2 mRNA fold difference:-2.0077127531668
Log2 TE fold difference:-0.87510199911751
Sequences
Protein sequence

MTENGVVTGGGHTVMVGVKFDESSNELLDWALVKVAEPGDTVIALHVLGNEIVDRADNSS
LVSIVKNFDSVLEVYEGFCKLKQLELKLKLSRGSSTRKILVKEAKMCSASKVVVGISRRF
HTIHSSVSVAKYLARKVAKDCWVLAVDNGKVMFQKDGSSSIIHHSKGKSDARRNTLSSFF
QMPVTLRKNTKVVNHSEVEEEEAEEDHSNGQSLRRSLVYACLGNCSVRDMNSLPTPGNLS
RSSSCNGDQDDNADLHKAMALVPAKFPEDLTPFITMLVKELPEFRPGWPLLCRVASSDVL
ASAPRSSSFRKIPVVQWVLKLPARTNSVVGSSDTKQIGFDSSESEENDKLSSSNVERQAI
VPDESMIVKCSLDHSSGRFPENVEGLQARISTSCQFFTYKELVSVTSNFCADNFIGKGGS
SRVFRGYLPNGREVAVKILKRTECVLKDFVAEIDIITTLHHKNVISLLGYCFENNNLLLV
YNYLSRGSLEENLHGNKKDLVAFRWNERYKVAVGIAEALDYLHNDAPQPVIHRDVKSSNI
LLSDDFEPQLSDFGLAKWASESTTQIICSDVAGTFGYLAPEYFMYGKMNNKIDVYAYGVV
LLELLSGRKPVNSESPKAQDSLVMWAKPILDDKEYSQLLDSSLQDDNNSDQMEKMALAAT
LCIRHNPQTRPTMGMVLELLKGDVEMLKWAKLQVSNPLEDSMLLKDEKLRRSNLQSHLNL
AFLDMEDDSLSMGSMEQGISVEEYLKGRTSRSSSFN

MTDEVDGDAWLSDLVDVSFLATKTAEQSEMIETGGDKQSSVEEGCGGRTILVGVKLDAPS
RELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVRTFDSVLDVYEGFCNLKQV
DLKLKLCRGSSARKILVREAKSFSATKVLVGISKSHHAIRSSASVAKYIAKKLSKDCWVI
AVNNGKILFQKEGSPSSTINQSQVVEETVIGFGYIGKEDVRRITLLNVLQRSVTLNKTTK
VVSHSEEDSNSKEEEEDQACGQNLRQVLAAARLENCSVCGFDSLSPNDTTTPGKLSGASD
FDRSEDDDECNKAMEIVPVNGSEDSGGSVTMLVRKLPEPRPGWPLLRRAVSTLGQSVTPH
KIPVVQWALKLPPRDTKQLGYDSSEDNLSTLNALVPFGINSITNKSIPDNSPRKLPEELE
GLYERFSSTCRFFKYKELVSVTSNFSADNFIGKGGSSRVFRGCLSNGRVVAVKILKQTED
VLNDFVAEIEIITTLHHKNIISLLGFCFEDHNLLLVYNYLSRGSLEENLHGNKKDPLAFC
WSERYKVAVGVAEALDYLHNTASQPVIHRDVKSSNILLSDDFEPQLSDFGLARWASISTT
HIICSDVAGTFGYLAPEYFMYGKVNDKIDVYAFGVVLLELLSGRKPISSGCPKGQESLVM
WAKPILDDGKYSQLLDPSLRDNNNNNDDQMQRMALAATLCIRRSPQARPKMSIVLKLLKG
DEDTLEWAMQQVNSSSEESEMLKDEQCQRSNLQSHLNLALLDVEDDSISMGSIEQGVSVE
DYLKGRTSRSSSFD

www.000webhost.com

Other information
Ka divergence:-0.35885KaKs divergence:-0.157823
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2271Length 2 (bp):2385Length divergence:0.024
MFE 1 (kcal):-684.25MFE 2 (kcal):-723.14MFE divergence0.028