Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21610-AT1G77310
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):wound-responsive family protein
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.6090451033775
Log2 mRNA fold difference:-1.1654530263124
Log2 TE fold difference:0.60080761007215
Sequences
Protein sequence

MSEVNEMSGGSIGGELLRASPKVLTAGDRKLLKVELRPGDTTYVSWKKLMRDAGKVNGLS
ASVPDPPPNANPNLEFRIAPGHPVEIETNEQPHSNRFNAVIEKIERLYKGNDSSDGEELD
GAPDDDEYDTEDSFIDDAELDEYFEVDNSTVKHDGFYVNRGKLERMEPSTTSNQQPKKRR
RKDSAKPCRDAVDVSDKHTKLSITARKKDQSTAPGSWKTQESPLPSGAQDANTSVPLDDV
KHSDRANHQSRNDTSHKSRETGSSSALHQKYSNKSLHQQSTSLLGKSPPNVFAEVTVVRQ
KENNGMHQLANVTGSRQSSQASKKDGSNVKSKTSILEKAIRELEKVVVESRPPAITENQE
ADTSSQAVKRRLPRDVKLKLAKVARIAQASQGKHSTELINRLMSIVGHLIQLRSLKRNLK
IMIDMGDSATREKDTRFKQINNEVLDMIKAKVSLMESQAIKPEGATSDDFQDSVEKPSLK
KFVMDAALEDKLCDLYDIFIDGLDEDQGPQTKKLYVNLAELWPNRLMDYRGIKHAIFRAK
ERRKALYGNLAKEMVDQTKMKKSMKQLVPRTDCTAQPNTELVVQRQHSGEKKLIVDPNAT
STSVVTSQTMVDRSNQQQPEKLKGISSSCNPTEETRVVKRKNEAVMAEKQVVLALKKPEH
PQTRVIPAPQNLNIPRTTPDLNLPS

MEDEPKLPTDDGPTFNESCKISSEILTAGDRKLLKVELLKEETTLVSWKKLMDEASKENG
GLFVSAPERLLNANPNLEFRLAPGAQTENEMVNQPHPNRLNSVIAKIERLYMGKDGSDGE
ELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFFVNRGKLERIEPSATSNQQQP
KKRRRKESAKPCGDVVDVSRKRAKMAKTAGGKDQSASPGPSSKKISNDSKTVQDSFSPLK
AQNGNDSLVLENVKHTDKANHQPMNATSPKSKAAGSSGPLHPKCSSKSVHEQSNSPPGKS
RPNVSAKSAVVRQQVNNGMPDLDIATESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLV
AESRPPAATENQDADISSQAVKRGLPGDVKLHLAKVARIAYASQGEISGELINRLMGIVG
HLIQIRSLKRNLKIMIDSIVTANREKDTRFQRIKSEITEMLKTQVPLVESQETNQEAGTS
DDFQDVGSLGKSPVKKFVMDVALEEKLCDLYDVFVEGMDEHSGSQIRKLYSDLAQLWPNS
LVDNHEIRRAICREKERRRALEGNIGKEMDQTKITKKKQTQLVPKSEGITYPDKTSGVEV
KASVVLTATTTSLVDCQPAADSSFERSKQQHEKLKRTSSLSNPAAEGKKVRRKTEPALEE
THLPAEKPLVLALKRQTHLKSKTHKQVQVHPQSKAHKQAQVHPKAKTQTPPDLNLPS

www.000webhost.com

Other information
Ka divergence:0.159826KaKs divergence:0.0312457
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):2058Length 2 (bp):2154Length divergence:0.023
MFE 1 (kcal):-593.91MFE 2 (kcal):-608.79MFE divergence0.012