Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21650-AT1G21651
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Preprotein translocase SecA family protein
Function (paralog2):zinc ion binding

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.45533191289391
Log2 mRNA fold difference:-0.31095060109332
Log2 TE fold difference:0.73270755737546
Sequences
Protein sequence

MEEPECPVCLQSYDGESTVPRVLACGHTACEECLTNLPKKFPDTIRCPACTVLVKFPPQG
PSALPKNIDLLRLFPSISKLKLEPGRNFEKVVEFVTRSWSDDFYATWKDRILVHDAVSVE
IRESESSDFDSSSRLCGSLRDDSKVSLLRVASFEHGDCDSVLKYSYVQRMMSCLWGMREE
ERDELDAIISVKQRGVSKVFGLWGDLKNGVLYLVGEKLIGFSLEEFDSLEDETLRLGIIG
MQICEALLNLHKEGLITGCLSVSCVKFDEYENAYVDLIELIETGRNVYRIIAEETSSLRK
PVGASEMGLIFVGLQQKGIFISSEVLFEFLKEQNMLIKNTSSKSFVSHNSDVWPVCFLLL
KLRLGKRCTEEFIESVNCVDGKGCEEGIEDILVLYTGITEKLSLESELQGKFKSMVEILR
QCCCLDPQARPVLTDLWKCIRELVMKPRFNSMSRLHKTIYGKRKQFCLAQSELCRLVEVE
SKEVDKELPGMKIGDEAEEGKVDIDFPGRVSEGKVRSKDMRGHQDSVTGLAVGGGFLFSS
SYDRTILIWSLKDFSHVHTFKGHQDKVMALIHIEGTEPVCVSGDGGGGIFVWSTTFPLEE
QPLRKWYEPKDWRYTGIHALAYSEYGHVYTGSGDNTIKAWSLQDGSLLCTMSGHKSVVST
LVVVNGVLYSGSWDGTVRLWSLSDNSLLTVLGEETPGIVRSILSLAADDQTLVAAYQNGD
IQIWRDDTLMKSMKIQNGAILSIAVNGKWLFTGGWDKTINVQELSGDEISVNCAHVGSIP
GSSVITSLLYWEGKLFAGFADKTIKGNLGRLKRNVQDFTSMNYWVVRDYYRLVESVNSLE
PQIQSLSDEQVKLSLKAKTAEFRERLARGESLADMQAEAFAVVREAAKRTIGMRHFDVQI
IGGGVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHR
FLGLSVGLIQRGMKAEERKFNYSCDITYTNNSELGFDYLRDNLTSNREQLVMRWPKPFHF
AIVDEVDSVLIDEGRNPLLISGEANENAARYPVAAKVAELLVKDSHYKVELKENSVELTE
EGISLAEMALETGDLWDENDPWARFVMNALKAKEFYKRDVQYIVRDGKALIINELTGRVE
DKRRWSEGVHQAVEAKEGLEIQADSIVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKM
FQIPVIEVPTNLSNIRIDLPIQAFATARGKWEHVRREVEDMFGQGRPVLVGTTSVENSEY
LSELLKEWGIPHNVLNARPKYAAREADFIAQAGRKYAITISTNMAGRGTDIILGGNPKML
AREIIEDSILSYLTSEVLADNIDDDELSQKVLSKIKVGPSSLALLARASLMAKYVGKSES
KSWTRKKAKSVVTESLEKSQTMDPMELQNLINEQSEMYPLGPAIALAYLSVLKDCEAHCL
HEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMISLQDEMFQKFNFDT
EWAVRLISKITNDEDLPIEGDTIVKQLLALQINAEKYFFGIRKSLVEFDEVLEVQRKHVY
DLRQLLLTGENESCSQHIFQYMQAVVDEIVVGNSNPQKHPRYWSLAKLLKEFMAISGNLL
DESFSGITEETMLQSLENLHEGSSIEMEDLSLPHLPKPPNAFRGIRRKNSSLRRWLDICS
DNLTGSGSYRTLINLLRKFLGDYLIASYLNVVQESGFDDGYIKEIERAVLLKTLDCYWRD
HLVNMNKLSSAVNVRSFAHRNPLEEYKIDGCRFFISMLSATRRLTVESILQYWSSPMESQ
ELFIS

MEEPECPVCLQSYDGESTVPRVLACGHTACEECLTNLPKKFPDTIRCPACTVLVKFPPQG
PSALPKNIDLLRLFPSISKLKLEPGRNFEKVVEFVTRSWSDDFYATWKDRILVHDAVSVE
IRESESSDFDSSSRLCGSLRDDSKVSLLRVASFEHGDCDSVLKYSYVQRMMSCLWGMREE
ERDELDAIISVKQRGVSKVFGLWGDLKNGVLYLVGEKLIGFSLEEFDSLEDETLRLGIIG
MQICEALLNLHKEGLITGCLSVSCVKFDEYENAYVDLIELIETGRNVYRIIAEETSSLRK
PVGASEMGLIFVGLQQKGIFISSEVLFEFLKEQNMLIKNTSSKSFVSHNSDVWPVCFLLL
KLRLGKRCTEEFIESVNCVDGKGCEEGIEDILVLYTGITEKLSLESELQGKFKSMVEILR
QCCCLDPQARPVLTDLWKCIRELVMKPRFNSMSRLHKTIYGKRKQFCLAQSELCRLVEVE
SKEVDKELPGMKIGDEAEEGKVDIDFPGRVSEGKVRSKDMRGHQDSVTGLAVGGGFLFSS
SYDRTILIWSLKDFSHVHTFKGHQDKVMALIHIEGTEPVCVSGDGGGGIFVWSTTFPLEE
QPLRKWYEPKDWRYTGIHALAYSEYGHVYTGSGDNTIKAWSLQDGSLLCTMSGHKSVVST
LVVVNGVLYSGSWDGTVRLWSLSDNSLLTVLGEETPGIVRSILSLAADDQTLVAAYQNGD
IQIWRDDTLMKSMKIQNGAILSIAVNGKWLFTGGWDKTINVQELSGDEISVNCAHVGSIP
GSSVITSLLYWEGKLFAGFADKTIKVYYFGR

Other information
Ka divergence:-1KaKs divergence:-0.999982
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):5418Length 2 (bp):2436Length divergence:-0.38
MFE 1 (kcal):-1635.87MFE 2 (kcal):-733.88MFE divergence-0.381