Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21670-AT1G21680
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):DPP6 N-terminal domain-like protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1324403173958
Log2 mRNA fold difference:1.8263615699816
Log2 TE fold difference:-0.55336343854442
Sequences
Protein sequence

MKLTNALFFFFLICLLSLSSASSNKPQLSNGSTILFTTIGRPTFEFDIFTLPTSHRPPSP
ADEHRLTDGKSINFNGYFASPSTALISLLPKRTQIQPQDVHLIYVTERAGTPSLNYDVVH
SDNVGSRIQVPLFSGEEQQSGMNVNSMKDTPVLTNGYLVHVSTHENPGKPMASWAAVYST
ELRTKSTRRLTPLGIADFSPAVSPSGKWTAVASFGEKGWTWSMVEKEISSDVYVFLTQDG
TQRVKVVEQGGWPRWVDDSTLYFHRKSDDGWISVYRAILPKTGPVTTKSVTIQRVTPPGL
HAFTPATSPNNNNFIAVATRRPGSEIRHVELFDLKKNEFVELTRLVSPKSHHFNPFLSPD
SSRVGYHSCRGDATGRKTPRNLLQSLKTTSNDLSLFRFDGAFPSISPEGDRFAFVSFTGV
FVVNPDGSGLRQLLPQMGFGTVWDPIRHGIVYTSSGPALAPGKSQIDILAINVDAPSPAT
AVKKLTTTGENNAFPWPSPDGKRIVFRSARSGTKNLYIMDAEKGESGGLFRLTNGNWNDT
IATWSPDGNWIVFASNREFPGTLLMNIYVVHPDGTGLRKLAQNLTGLVSMHPMFSPDSKR
IVFTTIYAGISAEQIGNPHFNVPSSEIFTVNLDGSGLTRLTHNSVEDGPPMWFPKIKATG
DVAWPKRFGPSCSIQDFKTQNTTVKMKMNKPATMSSMCVVPSQ

MNISQIIFFASLLLRLHLSTAEHQNSNAGDGDTIIFTTLGRSHYEFDIFALSTTQPPSVS
GELRITDGESVNFNGYFPSPSPALLSLLPDETLIQMEDSSPLHLIYVTERNGTSSLYYDL
VYGGNSDFKTKRRSVLEAPSRVQVPLLSRFDHLSGMTVNSFKDKPSLSGEFIVYVSTHES
SGEPRASWTAVYSTELKTGLTRRLTPSGVADFSPAVSPSGNLTAVASYGERGWTGEVEEL
RTDIYVFLTRDGSHRVKVVEHGGWPCWVDESTLYFHRRSEEDGWISVYRAILPENGPLTT
ESVTIQRVTPPGVHAFTPATSPNNHEFVAVATRRPGSDYRHVELFDLKRNEFIELTRLVA
PKSHHLNPFLSPDSSRVGYHSCRGDANGRRSPLLFLENIQTTTRDLSLFRIDGSFPSFSP
GGDRIAYVKMPGVFVVKPDGSGQREVYKGMAFSTAWDPVRPGIVYSSSGPTFATERTEVD
VISIDVDAADKSSSVRRLTTNGKNNAFPWPSPDGKRIVFRSGRTGHKNLYIMDAEKGESG
GLWRLTEGAWTDTMCNWSPDGEWIAFASDRESPGSGSFELFLIHPNGTGLRKLIQSGTGG
RTNHPIFSPDSKSLVFTSDYAGISAEPISNPHHYQPYGDIFTVKLDGSNVRRLTHNSYED
GTPAWAPRFIHPNNVELQRRNDSRCSFEDCHWLNKYPTLKGRKISC

www.000webhost.com

Other information
Ka divergence:-0.426475KaKs divergence:-0.355699
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):2112Length 2 (bp):2121Length divergence:0.002
MFE 1 (kcal):-681.93MFE 2 (kcal):-731.62MFE divergence0.035