Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21720-AT1G77440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):proteasome beta subunit C1
Function (paralog2):20S proteasome beta subunit C2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.3498993832811
Log2 mRNA fold difference:2.0816382491376
Log2 TE fold difference:-3.3914458231263
Sequences
Protein sequence

MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV
QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI
CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPDMEAEELFETISQALLSSVDRDCLS
GWGGHVYIVTPTEIKERILKGRMD

MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV
QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFI
CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPDMEAEELFETISQALLSSVDRDCLS
GWGGHVYVVTPKEVKERILKGRMD

www.000webhost.com

Other information
Ka divergence:-0.130454KaKs divergence:-0.293065
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):615Length 2 (bp):615Length divergence:0
MFE 1 (kcal):-178.22MFE 2 (kcal):-183.4MFE divergence0.014