Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21740-AT1G77500
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF630 and DUF632)
Function (paralog2):Protein of unknown function (DUF630 and DUF632)

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.54298238877608
Log2 mRNA fold difference:1.2214925666684
Log2 TE fold difference:-0.56236221266856
Sequences
Protein sequence

MGCGGSKVDDQPLVILCRERKQLIKAASHHRCALAAAHLSYFQSLCDVGDSIKRFVDEEL
VLVGTSSSSSPDSPVLTLPSDEGKPHKHKISSSSTSVSHSVIEDDDEGEGEDQHLHLSSG
SELDSGSESGSDDSLGHIHIETSPKVKEKETRLPENYQPGYQSGYQSGYQPGFTPGYQYQ
PGYSAGYQYPVEGWGFMGENPNLNPYPNPNQNPGMYFMKKSVQPSRPVVFQPENHRVENG
QWLPENGVGYSNYYPGNANTGYFGYPEQRREPPSPVRPTPAPPSPPRISSWDFLNVFDTY
DYNRAGGGESSGAGAGFFPAMGGGKSNSSSPDSREVREREGIPELEEETEQEVIFGQTFK
HMKRKGIEKVKEQHRQENEIHERKIKKRGDSGEGTSRAVPVVERATESSFGSKTVSSFSS
SEEESEFHHVNDGEGKSSSNDLGGHETVATKSVGEVEEEYVRKKGVSFELDENVTTSFDV
ESSKISSLSALSVHATRDLREVVKEIKSEFEVASSHGKEVAVLLEVSKLPYQQKSSGLKV
IFSRIMYLVAPSTVSSRSQPQPSIRLTSRILKIAKSYNGQDVREGLTGNLSATLEQLYAW
EKKLYKEVKDEEKLRVVYEEKCRTLKKLDSLGAESSKIDTTRAAIRKLLTKLDVCIRSVD
SISSRIHKLRDEELQPQLTQLIHGLIRMWRSMLKCHQKQFQAIMESKVRSLRANTGLQRD
SGLKAILDLEMELREWCISFNDWVNTQKSYVESLNGWLSRCLHYEPESTEDGIAPFSPSR
VGAPQVFVICKDWQEAMARISGENVSNAMQGFASSLHELWERQDEEQRQRVKAEYVSHDF
EKRLNDLRMERARVRMRNDQLQDGASEKSVVLSESGISALDDLKVDLDSMRKKLEEERAR
HKETIKLVNNAASSSLQAGLVPIFEALGNFTSQVVKAHEDVRFQQQQQPESED

MGCGGSKVDNQPIVILCRERKELLKAASYHRSALAVAHLTYFQSLSDVGEAIQRFVDDEV
VAGFSSSSSPDSPVLTLPSDEGKPTKHKRISPSSTTSISHSVIEEEDTDDDSHLHLSSGS
ESESEVGSKDHIQITSTPEQERSTESFPSGYHPTNYAPPVYPPGYPPGYPFSYPTGYSSG
NYQPGYPNYTGENPYGNRGMYYMKKSAPQSRPFIFQPENHRVEENAQWPSDSGFRNTGVQ
RRSPSPLPPPSPPTVSTWDFLNVFDTYDYSNARSRASGYYPMGMASISSSPDSKEVRERE
GIPELEEVTEQEVIKQVYRRPKRPGLEKVKEHRDEHKHNVFPERNINKREVPMPEQVTES
SLDSETISSFSGSDVESEFHYVNGGEGKSSSISSISHGAGTKSSREVEEQYGRKKGVSFE
LEETTSTSSFDVESSKISSLSSLSIHATRDLREVVKEIKSEFEIASSCGKEVALLLEVGK
LPYQHKNNGVKVILSRIMYLVAPSTRSSHSQPRLSIRLTSRTRKMAKSYNGQDVNGGFNG
NLSSTLEKLYAWEKKLYKEVKDEEKLRAIYEEKCRRLKKMDSHGAESIKIDATRAAIRKL
LTKIDVCIRSVDSISSRIHKLRDEELQPQLIQLIHGLIRMWRSMLRCHQKQFQAIRESKV
RSLKANTTLQNDSGSTAILDLEIELREWCISFNNWVNTQKSYVQFLSGWLTKCLHYEPEA
TDDGIAPFSPSQIGAPPIFIICKDWQEAMCRISGENVTNAMQGFASSLHELWEKQEEEQR
VKAQSEQRDAESERSVVSKGRSESGISALDDLKVDLDSMRKRLVEERGKGKETIKLVNNA
SSSSLKAGLVPIFGALRKFTSEVVKAHEIVRLQHPQTSS

Other information
Ka divergence:0.143264KaKs divergence:0.183911
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2862Length 2 (bp):2640Length divergence:-0.04
MFE 1 (kcal):-911.77MFE 2 (kcal):-789.88MFE divergence-0.072