Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21750-AT1G77510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PDI-like 1-1
Function (paralog2):PDI-like 1-2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.914295541997
Log2 mRNA fold difference:-1.3940661351962
Log2 TE fold difference:-0.51436295425481
Sequences
Protein sequence

MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCG
HCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAV
QEYNGPREAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFM
AIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKPFDEQFVDSKDFDGEALEKFVKE
SSIPLITVFDKDPNNHPYVIKFFESTNTKAMLFINFTGEGAESLKSKYREVATSNKGQGL
SFLLGDAENSQGAFQYFGLEESQVPLIIIQTADDKKYLKTNVEVDQIESWVKDFKDGKIA
PHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVS
YQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKN
KDTVGEPKKEEETTEEVKDEL

MAFKGFACFSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGH
CQKLAPEYEKAASELSSHNPPLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQ
DYNGPREAEGIVTYLKKQSGPASVEIKSADSATEVVGEKNVVAVGVFPKLSGDEFDSFMA
LAEKLRADYDFAHTLDAKFLPRGESVEGPAVRLFKPFDELFVDSKDFNGEALEKFVKESS
IPLVTVFDSDPNNHPYVAKFFESPATKAMMFVNFTGATAEALKSKYREVATSNKDQSLAF
LVGDAESSQGAFQYFGLEESQVPLIIIQTPDNKKYLKVNVEVDQIESWFKDFQDGKVAVH
KKSQPIPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAPILDEVALSFQ
NDPSVIIAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNSE
KKPTSHGEESTKSEEPKKTEETAAKDEL

www.000webhost.com

Other information
Ka divergence:0.141796KaKs divergence:0.319844
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1506Length 2 (bp):1527Length divergence:0.007
MFE 1 (kcal):-459.64MFE 2 (kcal):-452.53MFE divergence-0.008