Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21770-AT1G77540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Acyl-CoA N-acyltransferases (NAT) superfamily protein
Function (paralog2):Acyl-CoA N-acyltransferases (NAT) superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.30442522280892
Log2 mRNA fold difference:-2.3970780740611
Log2 TE fold difference:2.66912587152
Sequences
Protein sequence

MATGTATEKPKIVWNEGRHRFETDDHEAFIEYKMKNDGKVMDLVRTFVPPSKAGLGLASH
LCVAAFEHASEHSFSIIPTCSYVSETFLHRNPTWQRLVHSEDDSKNLKSSI

MTNTAATTEAKMATEPPKIVWNEGKRRFETEDHEAFIEYKMRNNGKVMDLVHTYVPSFKR
GLGLASHLCVAAFEHASSHSISIIPSCSYVSDTFLPRNPSWKPLIHSEVFKSSI

www.000webhost.com

Other information
Ka divergence:-0.474655KaKs divergence:0.100974
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):336Length 2 (bp):345Length divergence:0.013
MFE 1 (kcal):-98.4MFE 2 (kcal):-101.4MFE divergence0.015