Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21810-AT1G77580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein of unknown function (DUF869)
Function (paralog2):Plant protein of unknown function (DUF869)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.3602773105613
Log2 mRNA fold difference:1.8483768685748
Log2 TE fold difference:-0.59978048696773
Sequences
Protein sequence

MTGTTLILEPVMDSKDELVKQHAKVAEDAVAGWEKAENEVVELKQKLEDAADKNIVLEDR
VSHLDGALKECVRQLRQFRDEQEKNIQAAVTESTKELHSANTGLEKRVLELQKEAEAAKS
ENMMLRREFLTQREDLEIVMIERDLSTQAAETASKQHLDIIKKLAKLEAECRKLRILAKT
SSSLSSNQSVDSHSDGGRERVEGSCSDSWASSAFISELDQIKNEKGGNRSLQGTTSSTEI
DLMDDFLEMERLVALPTETQAKNSKDGYELSLMEKLEKIQAEKDDLEREVKCCREAEKRL
SLEIEAVVGDKMELEDMLKRVEAEKAELKTSFDVLKDKYQESRVCFQEVDTKLEKLQAEK
DELDSEVICCKEAEKRFSLELEAVVGDKIEMEDELEKMEAEKAELKISFDVIKDQYQESR
VCFQEVEMKLEAMKRELKLANESKTQAESRVTRMEAEVRKERIVSDGLKEKCETFEEELR
REIEEKTMIKREKVEPKIKQEDIATAAGKFADCQKTIASLGKQLQSLATLEEFLIDTASI
PGSARSVHNKEALLGKDPHECIKTINGRSLEFLAIQNSNNKTSPPCSSSSDSTTVSLIMS
SNRGSSEKNRNGFATVFTRSRNSVNLGI

MEKRKRESSERSFGESESVSSLSEKDSEIQPESTMESRDDEIQSPTVSLEVETEKEELKD
SMKTLAEKLSAALANVSAKDDLVKQHVKVAEEAVAGWEKAENEVVELKEKLEAADDKNRV
LEDRVSHLDGALKECVRQLRQARDEQEQRIQDAVIERTQELQSSRTSLENQIFETATKSE
ELSQMAESVAKENVMLRHELLARCEELEIRTIERDLSTQAAETASKQQLDSIKKVAKLEA
ECRKFRMLAKSSASFNDHRSTDSHSDGGERMDVSCSDSWASSTLIEKRSLQGTSSSIELD
LMGDFLEMERLVALPETPDGNGKSGPESVTEEVVVPSENSLASEIEVLTSRIKELEEKLE
KLEAEKHELENEVKCNREEAVVHIENSEVLTSRTKELEEKLEKLEAEKEELKSEVKCNRE
KAVVHVENSLAAEIEVLTSRTKELEEQLEKLEAEKVELESEVKCNREEAVAQVENSLATE
IEVLTCRIKQLEEKLEKLEVEKDELKSEVKCNREVESTLRFELEAIACEKMELENKLEKL
EVEKAELQISFDIIKDKYEESQVCLQEIETKLGEIQTEMKLVNELKAEVESQTIAMEADA
KTKSAKIESLEEDMRKERFAFDELRRKCEALEEEISLHKENSIKSENKEPKIKQEDIETA
AGKLANCQKTIASLGKQLQSLATLEDFLTDTPIIPMAANGVSSSSNSESWKVHKNETFMT
RNHPESIKPTKETSPSSSSSTASAAVSMPVSTNRGSSEKNRNGFATVFTRSKDGIHLAI

www.000webhost.com

Other information
Ka divergence:-0.307628KaKs divergence:-0.206628
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1887Length 2 (bp):2340Length divergence:0.107
MFE 1 (kcal):-522.16MFE 2 (kcal):-670.68MFE divergence0.125