Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21880-AT1G77630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):lysm domain GPI-anchored protein 1 precursor
Function (paralog2):Peptidoglycan-binding LysM domain-containing protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.71069465308187
Log2 mRNA fold difference:-0.5605615987784
Log2 TE fold difference:-0.16429195919561
Sequences
Protein sequence

MKIPEKPIFLIFVSLILASSLTFTATAKSTIEPCSSNDTCNALLGYTLYTDLKVSEVASL
FQVDPISILLANAIDISYPDVENHILPSKLFLKIPITCSCVDGIRKSVSTHYKTRPSDNL
GSIADSVYGGLVSAEQIQEANSVNDPSLLDVGTSLVIPLPCACFNGTDNSLPAVYLSYVV
KEIDTLVGIARRYSTTITDLMNVNAMGAPDVSSGDILAVPLSACASKFPRYASDFGLIVP
NGSYALAAGHCVQCSCALGSRNLYCEPASLAVSCSSMQCRNSNLMLGNITVQQTSAGCNV
TTCDYNGIANGTILTMLTRSLQPRCPGPQQFAPLLAPPDTVPRDVMYAPAPSPDFDGPGS
IASSPRSSMLPGGGILPGNPANGPAGSISTASASSVSYFFITFLISIASFSLALSS

MKNPEKPLLLFLILASSLASMATAKSTIEPCSSKDTCNSLLGYTLYTDLKVTEVASLFQV
DPVSMLLSNSIDISYPDVENHVLPAKLFLKIPITCSCVDGIRKSLSTHYKTRTSDTLGSI
ADSVYGGLVSPEQIQVANSETDLSVLDVGTKLVIPLPCACFNGTDESLPALYLSYVVRGI
DTMAGIAKRFSTSVTDLTNVNAMGAPDINPGDILAVPLLACSSNFPKYATDYGLIIPNGS
YALTAGHCVQCSCVLGSRSMYCEPASISVSCSSMRCRNSNFMLGNITSQQSSSGCKLTTC
SYNGFASGTILTTLSMSLQPRCPGPQQLAPLIAPPDNVPKELMYLPSPSPSPSPEFDDIA
GGGSSIAAVPAASPGGATVSSSNSIPGNPANGPGGSISIASCPLSYYSFIALLIPIGSCF
FVF

www.000webhost.com

Other information
Ka divergence:0.458859KaKs divergence:-0.304367
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1251Length 2 (bp):1272Length divergence:0.008
MFE 1 (kcal):-331.63MFE 2 (kcal):-351.6MFE divergence0.029