Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21910-AT1G77640
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Integrase-type DNA-binding superfamily protein
Function (paralog2):Integrase-type DNA-binding superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.5169268065032
Log2 mRNA fold difference:-2.2332103027617
Log2 TE fold difference:-0.18801857507773
Sequences
Protein sequence

MVKQERKIQTSSTKKEMPLSSSPSSSSSSSSSSSSSSCKNKNKKSKIKKYKGVRMRSWGS
WVSEIRAPNQKTRIWLGSYSTAEAAARAYDVALLCLKGPQANLNFPTSSSSHHLLDNLLD
ENTLLSPKSIQRVAAQAANSFNHFAPTSSAVSSPSDHDHHHDDGMQSLMGSFVDNHVSLM
DSTSSWYDDHNGMFLFDNGAPFNYSPQLNSTTMLDEYFYEDADIPLWSFN

MVKQELKIQVTTSSSSLSHSSSSSSSSTSALRHQSCKNKIKKYKGVRMRSWGSWVTEIRA
PNQKTRIWLGSYSTAEAAARAYDAALLCLKGPKANLNFPNITTTSPFLMNIDEKTLLSPK
SIQKVAAQAANSSSDHFTPPSDENDHDHDDGLDHHPSASSSAASSPPDDDHHNDDDGDLV
SLMESFVDYNEHVSLMDPSLYEFGHNEIFFTNGDPFDYSPQLHSSEATMDDFYDDVDIPL
WSFS

Other information
Ka divergence:0.132488KaKs divergence:-0.220165
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):693Length 2 (bp):735Length divergence:0.029
MFE 1 (kcal):-203.96MFE 2 (kcal):-196.71MFE divergence-0.018