Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21920-AT1G77660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Histone H3 K4-specific methyltransferase SET7/9 family protein
Function (paralog2):Histone H3 K4-specific methyltransferase SET7/9 family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-3.7254114901941
Log2 mRNA fold difference:-3.089189353308
Log2 TE fold difference:-0.44695317298248
Sequences
Protein sequence

MEKQAKLTRTQSSLLRSSSNLRSSYQSLSSIVEGEQDLEAGEKEEKQRRKPPKPFGSPNP
KTGLTRINPGLAFTMVSLSFLSLSSFFFFVVFSQTDEILTSENLLLALIFVAVALFFASK
NISLLNQTVIAIKNLGFQNRDSKSKPVQWYIGDDSKPEKKVIKRFVKEGVQFYSNGDFYE
GEFNKGKCNGSGVYYYFVRGRYEGDWLDGRYDGHGIESWARGSRYKGQYRQGLRHGFGVY
RFYTGDCYAGEWFNGQSHGFGVQSCSDGSSYLGESRFGVKHGLGSYHFRNGDKYAGEYFG
DKIHGFGVYRFANGHCYEGAWHEGRKQGFGAYSFRNGDAKSGEWDSGVLVTSLPLTSEPV
SRAVQAARETANKAVNRRRVDEQVSRAVAAANKAATAARVAAVRAVQNQMDGKFCQS

MSQKKLTRTQSSLLRSSPTIRSSIQSLSSITECDDFNETSHHRREQDLEAGEKEEKQRRR
KPVKSFGSMNRIKPGLAFTLACLSFLSLSSFLLFFVDEIFTSENLLLGLIFVALALFFAS
RNMAVINQTVIAIKQIRVRSRIKHKPKPVQWYIGDSKPEPIKEEETRLVVKEGVQFFSNG
DFYEGEFNRGKCNGSGVYYYYVNGRYEGDWINGRYDGYGIECWSKGSKYKGQYKQGLRHG
FGVYWFYTGDSYSGEWFNGQSHGFGVQTCADGSSFVGEFKFGVKHGLGSYHFRNGDKYAG
EYFGDKIHGFGVYHFANGHYYEGAWHEGRKQGYGTYRFRTGDIKSGEWDDGNLVNHLPLD
SDPVRRAVQSARERAKNGVNQRRIDEQVIRAVAAANKAATAARVAAVKAVQNQMDGKICD
N

Other information
Ka divergence:0.151302KaKs divergence:0.071298
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):1254Length 2 (bp):1266Length divergence:0.005
MFE 1 (kcal):-401.04MFE 2 (kcal):-394.53MFE divergence-0.008