Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G21980-AT1G77740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phosphatidylinositol-4-phosphate 5-kinase 1
Function (paralog2):phosphatidylinositol-4-phosphate 5-kinase 2

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.57713710222208
Log2 mRNA fold difference:0.35553149410114
Log2 TE fold difference:0.17942488911299
Sequences
Protein sequence

MSDSEEDEEEEEASEVILSSVVQKKKKKNLRFGEEVERRDGLVLLAQSTPMVRSRSQGTT
RRVTPTPLVDVEKPLPNGDLYIGSFSGGFPHGSGKYLWKDGCMYEGDWKRGKASGKGKFS
WPSGATYEGEFKSGRMEGFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRN
LQDGRGRYVWRNGNQYTGEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTWSDGS
SCVGAWNESNIMRSFFNGVEKNDLIVGNRKRSSVDSGAGSLGGEKVFPRICIWESDGEAG
DITCDIIDNVEASMIYRDRISVDRDGFRQFKKNPCWFNGEAKKPGQTISKGHKKYDLMLN
LQLGIRYSVGKHASIVRDLKQTDFDPKEKFWTRFPPEGTKTTPPHQSVDFRWKDYCPLVF
RRLRELFQVDPAKYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVLLR
MLPSYYKHVCQYENSLVTRFYGVHCVKPVGGQKTRFIVMGNLFCSEYRIQRRFDLKGSSH
GRSTAKPEGEIDETTTLKDLDLNFSFRLQRNWYQELMKQIKRDCEFLEAERIMDYSLLVG
VHFRDDNTGEKMGLSPFVLRSGRIDSYQNEKFMRGCRFLEAELQDMDRILAGRKPSIRLG
ANMPAKAERMARRSDFDQYSSGGASYPSHGEMYEVVLYFGVIDILQDYDITKKIEHAYKS
LQADPASISAVDPKLYSKRFRDFISRIFIEEG

MMREPLVSEEEEEEATEVLLVEKTKLCKRRGDEEKTEERRDDLLLLALTPMVRSKSQGTT
RRVTPTPPPVDVEKPLPNGDLYMGTFSGGFPNGSGKYLWKDGCMYEGEWKRGKASGKGKF
SWPSGATYEGEFKSGRMEGSGTFVGVDGDTYRGSWVADRKQGHGQKRYANGDYYEGTWRR
NLQDGRGRYVWMNGNQYTGEWRNGVICGKGVLAWPNGNRYEGQWENGVPKGSGVFTWADG
SSWIGSWNESSNLMRNFFDGIEKNELIVATRKRSSVDSGAGSLTGEKIFPRICIWESDGE
AGDITCDIVDNVEASVIYRDRISIDKDGFRQFRKNPCCFSGEAKKPGETISKGHKKYDLM
LNLQHGIRYSVGKHASVVRDLKQSDFDPSEKFWTRFPPEGSKTTPPHLSVDFRWKDYCPL
VFRRLRELFTVDPADYMLAICGNDALRELSSPGKSGSFFYLTQDDRFMIKTVKKSEVKVL
LRMLPSYYKHVCQYENTLVTRFYGVHCIKPVGGQKTRFIVMGNLFCSEYRIQRRFDLKGS
SHGRYTSKPEGEIDETTTLKDLDLNFAFRLQRNWYQELMTQIKRDCEFLEAERIMDYSLL
VGVHFRDDNTGDKMGLSPFVLRSGKIESYQSEKFMRGCRFLEAELQDMDRILAGRKPLIR
LGANMPARAERMARRSDYDQYSSGGTNYQSHGEVYEVVLYFGIIDILQDYDISKKIEHAY
KSLQADPASISAVDPKLYSRRFRDFISRIFIEDG

Other information
Ka divergence:0.0742645KaKs divergence:-0.0126206
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2259Length 2 (bp):2265Length divergence:0.001
MFE 1 (kcal):-667.8MFE 2 (kcal):-688.98MFE divergence0.016