Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22050-AT1G77870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):membrane-anchored ubiquitin-fold protein 6 precursor
Function (paralog2):membrane-anchored ubiquitin-fold protein 5 precursor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1605518825516
Log2 mRNA fold difference:0.61986849233528
Log2 TE fold difference:0.43544383625077
Sequences
Protein sequence

MAGEEDWIELKFRLADGTDIGPSKYNQSMTVSSLKEKLISQWPKDKENTPKTVNDMKLIN
AGKILENNRTLAESRLPVCELPGMIITMHIVLRLPTLDKKSEKLQNDPPMKNRCVCTIL

MGDEDLIELKFRLADGTDIGPSKYSQFMTVASLKEKIIAQWPKDKENAPKMINEVKLING
GKILENNKTLSEARSLITIGELPGIVTTMHVVLRPPLFEKKKEKLQNDPPRKSHCVCCIL

www.000webhost.com

Other information
Ka divergence:0.138589KaKs divergence:0.579977
GC content 1 (%):38GC content 2 (%):38GC content divergence:0
Length 1 (bp):360Length 2 (bp):363Length divergence:0.004
MFE 1 (kcal):-84.23MFE 2 (kcal):-89.5MFE divergence0.03