Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22070-AT1G77920
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):TGA1A-related gene 3
Function (paralog2):bZIP transcription factor family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.30747740222156
Log2 mRNA fold difference:0.69787932224687
Log2 TE fold difference:-0.45822217916133
Sequences
Protein sequence

MEMMSSSSSTTQVVSFRDMGMYEPFQQLSGWESPFKSDINNITSNQNNNQSSSTTLEVDA
RPEADDNNRVNYTSVYNNSLEAEPSSNNDQDEDRINDKMKRRLAQNREAARKSRLRKKAH
VQQLEESRLKLSQLEQELVRARQQGLCVRNSSDTSYLGPAGNMNSGIAAFEMEYTHWLEE
QNRRVSEIRTALQAHIGDIELKMLVDSCLNHYANLFRMKADAAKADVFFLMSGMWRTSTE
RFFQWIGGFRPSELLNVVMPYVEPLTDQQLLEVRNLQQSSQQAEEALSQGLDKLQQGLVE
SIAIQIKVVESVNHGAPMASAMENLQALESFVNQADHLRQQTLQQMSKILTTRQAARGLL
ALGEYFHRLRALSSLWAARPREHT

MMSSSSPTQLASLRDMGIYEPFQQIVGWGNVFKSDINDHSPNTATSSIIQVDPRIDDHNN
NIKINYDSSHNQIEAEQPSSNDNQDDDGRIHDKMKRRLAQNREAARKSRLRKKAYVQQLE
ESRLKLSQLEQELEKVKQQGHLGPSGSINTGIASFEMEYSHWLQEQSRRVSELRTALQSH
ISDIELKMLVESCLNHYANLFQMKSDAAKADVFYLISGMWRTSTERFFQWIGGFRPSELL
NVVMPYLQPLTDQQILEVRNLQQSSQQAEDALSQGIDKLQQSLAESIVIDAVIESTHYPT
HMAAAIENLQALEGFVNQADHLRQQTLQQMAKILTTRQSARGLLALGEYLHRLRALSSLW
AARPQEPT

www.000webhost.com

Other information
Ka divergence:-0.0665854KaKs divergence:-0.524324
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):1155Length 2 (bp):1107Length divergence:-0.021
MFE 1 (kcal):-356.6MFE 2 (kcal):-286.54MFE divergence-0.109