Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22150-AT1G78000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sulfate transporter 1;3
Function (paralog2):sulfate transporter 1;2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.9085410951678
Log2 mRNA fold difference:5.5088492068436
Log2 TE fold difference:-1.5983316933833
Sequences
Protein sequence

MSARAHPVDDDGEISPVERSSPRQANTPYVHKVEVPPKQNLFNEFMYTFKETFFHDDPLR
HFKDQSKSKKLMLGIQSVFPVIEWGRKYNLKLFRGDLIAGLTIASLCIPQDIGYAKLASL
DPKYGLYSSFVPPLVYACMGSSKDIAIGPVAVVSLLLGTLLRAEIDPNTNPNEYLRLAFT
STFFAGVTQAALGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGINKFTKKTDI
IAVLSSVISSAHHGWNWQTILISASFLIFLLISKFIGKRNKKLFWIPAIAPLVSVIISTF
FVYITRADKKGVQIVKHLDKGLNPSSLRLIYFSGDYLLKGFRIGVVSGMVALTEAVAIGR
TFAAMKDYQIDGNKEMVALGAMNVIGSMTSCYVSTGSFSRSAVNFMAGCQTAVSNIIMSI
VVLLTLLFLTPLFKYTPNAILAAIIINAVIPLVDVNATILIFKIDKLDFVACMGAFFGVI
FVSVEIGLLIAVGISFAKILLQVTRPRTAILGKIPGTSVYRNINQYPEATRIPGVLTIRV
DSAIYFSNSNYVRERIQRWLTDEEEMVEAARLPRIQFLIIEMSPVTDIDTSGIHALEDLY
KSLQKRDIQLVLANPGPPVINKLHVSHFADLIGHDKIFLTVAEAVDSCSPKLSDEV

MSSRAHPVDGSPATDGGHVPMKPSPTRHKVGIPPKQNMFKDFMYTFKETFFHDDPLRDFK
DQPKSKQFMLGLQSVFPVFDWGRNYTFKKFRGDLISGLTIASLCIPQDIGYAKLANLDPK
YGLYSSFVPPLVYACMGSSRDIAIGPVAVVSLLLGTLLRAEIDPNTSPDEYLRLAFTATF
FAGITEAALGFFRLGFLIDFLSHAAVVGFMGGAAITIALQQLKGFLGIKKFTKKTDIISV
LESVFKAAHHGWNWQTILIGASFLTFLLTSKIIGKKSKKLFWVPAIAPLISVIVSTFFVY
ITRADKQGVQIVKHLDQGINPSSFHLIYFTGDNLAKGIRIGVVAGMVALTEAVAIGRTFA
AMKDYQIDGNKEMVALGMMNVVGSMSSCYVATGSFSRSAVNFMAGCQTAVSNIIMSIVVL
LTLLFLTPLFKYTPNAILAAIIINAVIPLIDIQAAILIFKVDKLDFIACIGAFFGVIFVS
VEIGLLIAVSISFAKILLQVTRPRTAVLGNIPRTSVYRNIQQYPEATMVPGVLTIRVDSA
IYFSNSNYVRERIQRWLHEEEEKVKAASLPRIQFLIIEMSPVTDIDTSGIHALEDLYKSL
QKRDIQLILANPGPLVIGKLHLSHFADMLGQDNIYLTVADAVEACCPKLSNEV

www.000webhost.com

Other information
Ka divergence:0.172657KaKs divergence:0.27942
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1971Length 2 (bp):1962Length divergence:-0.002
MFE 1 (kcal):-566.44MFE 2 (kcal):-592.09MFE divergence0.022