Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22160-AT1G78020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF581)
Function (paralog2):Protein of unknown function (DUF581)

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:4.2918196421036
Log2 mRNA fold difference:3.0745594982028
Log2 TE fold difference:1.14569795772
Sequences
Protein sequence

MLLGKRQRPPIKRTTSLSEIKFDLNQPSEQEPSDHQIQLVNVDEHRQVHQRLLDQRLLAM
VSPRGTQRRHSSDYSEDFLRSCSLCKRLLVHGRDIYMYRGDRAFCSLECRQQQITVDERK
EKKKGSVRSTIVVATGTTTGERVSAAV

MLLGKRQRPPINRTTSLSEIKFDLNLPSESEPSNQQKPTVASPYGSNGQAVTAAVDQNRG
FLDQRLLSMVTPRGNLRRHSGDFSDAGHFLRSCALCERLLVPGRDIYMYRGDKAFCSSEC
RQEQMAQDERKEKGKSAAPAKEPAVTAPARAKPGKGRAAAAV

Other information
Ka divergence:-0.0341207KaKs divergence:0.50197
GC content 1 (%):44GC content 2 (%):51GC content divergence:0.074
Length 1 (bp):444Length 2 (bp):489Length divergence:0.048
MFE 1 (kcal):-117.8MFE 2 (kcal):-173.8MFE divergence0.192