Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G22170-AT1G78050
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Phosphoglycerate mutase family protein
Function (paralog2):phosphoglycerate/bisphosphoglycerate mutase

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.061281336471917
Log2 mRNA fold difference:-0.67044137193372
Log2 TE fold difference:0.57966854505562
Sequences
Protein sequence

MATATSHQSVVSFASLRSSPSSTISQCGFKIDSSLSFTSKKTNFCKIKAMASSVSYDNTL
LSPSKTIPDNSQKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRIS
NIPVDVIFTSSLIRAQMTAMLAMIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPV
IPAWQLNERMYGELQGLNKQETAERYGKEQVHEWRRSYDIPPPKGESLEMCAERAVAYFQ
DNIEPKLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIFKEGKFMKR
GSPVGPTEAGVYAYTKRLAQYRQKLEDDSEVLCA

MATSTTMSHQAIGSVVSQRPFKASQFLKEPLNNVPMKFRQKRFKIEATASQISVVDNTFL
SPSPSKNKPHESKKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTQKGVGEAIEAGKKI
SNIPVDLIFTSSLIRAQMTAMLAMTQHRRKKVPIILHNESVKAKTWSHVFSEETRKQSIP
VIAAWQLNERMYGELQGLNKKETAERYGTQQVHEWRRSYEIPPPKGESLEMCAERAVAYF
EDNIKPELASGNNVMIAAHGNSLRSIIMYLDDLTSQEVTTLDLSTGVPLLYIFKEGKFMK
RGSPVGSTEAGVYAYTKRLAQYREKLDAAATI

Other information
Ka divergence:0.255235KaKs divergence:-0.0700525
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1005Length 2 (bp):999Length divergence:-0.003
MFE 1 (kcal):-289.84MFE 2 (kcal):-280.81MFE divergence-0.016